KEGG   Roseobacter denitrificans: RD1_0123Help
Entry
RD1_0123          CDS       T00376                                 

Gene name
bchD
Definition
magnesium chelatase subunit D (EC:6.6.1.1)
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
rde  Roseobacter denitrificans
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rde00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    RD1_0123 (bchD)
Enzymes [BR:rde01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     RD1_0123 (bchD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RoseoBase: 
UniProt: 
Position
122796..124454
Genome map
AA seq 552 aa AA seqDB search
MSHESDSWDRAALALRLLTVENADLGGAVIRMRASPARDHVLAALRGLKLRKIHPTISDD
QLFGGLDLAATLESSHLVENTSFFDDKTNALLVMAERCGTGLAAKLAQILDRDAGHMLIA
LDEGAEADEHAPPALADRLALHIEPEGRMPEGWQPAPAGTSALDPRHVTVSAGDIQTLAE
IAAVFGIDSLRAPLLALRVARAHAALNGRDKVTDSDLNVAAELTYPHRATRLPQEPDAAE
DPPAPPEDSPEDDAAGDSDTLSLPEGDMLVEAVKALLPPDLLAGLAPAGTSRGASGAGAG
QKRKGNRRGRPLPSRPGRLDGRARIDLVATLRAAAPWQPLRQRAVPTRTGLHIRPSDIRL
KRYQEQSDRLLIFTVDASGSAAMSRLNEAKGAVELLLAQAYAARDHVALVAFRGEGAELL
LPPTRSLVQTKRRLASLPGGGGTPLAAGLQQAALLAQQSRSKGLTPTVVVLTDGRANIAL
DGTPDRTAAQADSEQMAQIIQTQNIAALVIDMSKRPQEPLRALSARLGAPYLALPRADAE
RLTGAVNAALDA
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
gtgagccatgagtccgacagctgggatcgcgcggcccttgcgctccggcttttgacggtt
gaaaacgcggacctcggtggtgccgtcattcggatgcgcgccagtccggcgcgggatcac
gttcttgccgcgctgcgcgggctgaaactgcgcaagattcatcccaccatcagcgacgac
cagctgtttggcggcctcgaccttgccgcaacgctggaaagctcgcaccttgttgaaaac
acgtcattctttgacgataaaaccaatgccctgctggtgatggcagagcggtgcggcacc
gggctggccgcaaagctggcacagatcctcgacagggatgccggccatatgctgatcgcg
cttgatgaaggtgccgaagcggatgagcacgcaccccctgcccttgccgaccggcttgcg
ctgcacatcgaacccgaaggccgtatgccggaggggtggcaacctgcccccgcaggaaca
tcggcgcttgacccccgccacgtgacagtgagcgcaggcgatatccaaacccttgccgag
atcgcggcggttttcggcatcgacagtttgcgcgcgcctttgctggcgctgcgtgtggcg
cgggcgcatgcggcgctgaacggacgcgacaaggtgacggacagcgatctcaatgtggct
gccgaactgacctatccacaccgcgccacgcggcttccgcaagaacccgacgccgccgaa
gatccccccgccccgcccgaagattcgcccgaggatgacgcggcaggcgacagcgatacc
ctgtccctgcccgaaggcgacatgctggtcgaagccgtcaaagccttgttgccgcccgac
ctgctggcgggtcttgcccctgcggggacatcgcgcggggcaagtggcgcgggggccggg
caaaaacgcaaaggcaaccgccggggtcgccctctgccctcccgacccgggcggcttgac
gggcgcgcccgcattgatctggtggcgactttgcgtgctgccgccccgtggcaaccgctg
cgccaacgggctgtcccgacacgaaccggcctgcacatccgcccttcggacatccgcctc
aaacggtatcaggagcaatcggaccggctgctgatattcacggttgatgcctccggctct
gccgccatgtcgcgcctgaacgaagccaagggcgctgtcgaattgctgctggcacaagcc
tatgccgcccgcgatcacgtggcccttgtggcctttcgcggtgagggggccgagttgctg
ttgccacccacgcgatcactggtgcaaacaaagcgccgtctggccagcctgcccggcggc
ggcggcaccccgctggccgctggcctgcaacaggccgctctgctcgcgcagcaaagccgc
tcgaaagggctgaccccgacggtcgtcgttctgacggacggccgtgccaacatcgcattg
gacggcacgccggatcgcacggcagcacaagccgactcagaacagatggctcaaatcatt
cagacccagaacatcgccgcattggtgattgacatgtccaaacgcccgcaagagccgctc
agggctttgtccgcgcggcttggcgcgccatatcttgctctgccccgcgccgatgcagag
cggcttaccggggccgtcaacgcagcactggacgcctag

  All links  
No link information was found.   
DBGET integrated database retrieval system