KEGG   Roseobacter denitrificans: RD1_0137Help
Entry
RD1_0137          CDS       T00376                                 

Gene name
bchH
Definition
magnesium chelatase subunit H (EC:6.6.1.1)
Orthology
K03403  
magnesium chelatase subunit H [EC:6.6.1.1]
Organism
rde  Roseobacter denitrificans
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rde00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    RD1_0137 (bchH)
Enzymes [BR:rde01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     RD1_0137 (bchH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RoseoBase: 
UniProt: 
Position
complement(134968..138540)
Genome map
AA seq 1190 aa AA seqDB search
MRDEVGINGQLPGYRVVVVTLDSHAAGPAMRAAERLSADYPGLDVSIHAAAEWGETPGTF
EAAKAAVETGDIIIANLLFLEEHYARILPSLEARRPHCDAMIGVIADASIVKLTKMGALD
MMAPKSGAMKLMKKLRGSSKPSSSSGADKMALLRRLPKILKFIPGKSQDLRAWFMSMQYW
LGGSDDNVEAMMRFLLNRYARNPGWAKAPEAPAPIEYPDAGLYHPDLPTRITTDLNDLPR
PEGATATVGLLLMRSYVLSSDTAHYDAVIRSFEARGIAVRAAFAGGLDGRPAIDAYFRDQ
SGTQIDAMVSLTGFSLVGGPAYNDNDAAIAVLKDLDVPYLAAHPLEFQTLEQWACSTQGL
GPIETTMLIALPELDGATNPTVFAGRHGTAGCHGCNHDCEMKSDHKAMAPCIERVDSLVE
KTIRMTTLRRKTNAEKTLGIVLFGFPPNAGAVGTAAYLSVFESLFNTLHRLKADGYDVEV
PETVDALRDKVLAGNARQYGQEANVADHVTADTIVKTTPPLAAIEAVWGPAPGRIQSDGR
GVFILGAHFGKVFVGVQPAFGYEGDPMRLLFEKGFAPTHAFTTFYLWLRNTLKADAILHF
GMHGALEFMPGKQAGLGARDWPDRLIGEMPNIYLYASNNPSEASLAKRRSGAVTITHLTP
PLAASGLYKGLLDLKDSLTRWRAMDQDSDERDELQALIAQQADAVDMGDVTPDQLWLKLL
ETEDALIPDGLHILGKPLSDAARAEYLSIMDHADDATRARVDALLQQETELDAICRALSA
RYIAPVPGGDLIRSTDILPTGRNIHAFDPFRMPTAFACQDGAKQAQLLLDTHQTLPRTVA
LVLWGSDNIKSDGGPIAQALALMGCVPRFDSFGRLAGADLISLEDLGRPRIDVIMTLSGI
FRDLLPLQTRMLAEAAQKCAMADEPVELNYIRAHALAYAEKTGCDMAEASLRVFSNAEGA
YGSNVNQLVDSSAFGDEDELADAYQARKSFAYGTDGKASSNAALLQSQLAEVDVAYQNLE
SVELGVTTVDHYFDTLGGIARAVKRAKGSEAAVYIGDQTRGSGKVRTLKEQVALETRSRS
LNPKFFEGLLKHGAEGVRQIEAQVTNTMGWSATTGQVDPWVYQRLSETFVLDEDMRQRLA
DLNPTASSRMANRLLEAHDRNYWSPDAETLAALQDAADALEDQLEGIAAQ
NT seq 3573 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgatgaggttggcataaacgggcaactgcccggctatcgcgtggtggttgtcacg
ctggacagccatgcggcgggtccggccatgcgcgcggcagaacgtctgtctgcggattac
cccgggctggatgtgtccattcacgcagcggcggaatggggcgaaacacccggcaccttt
gaagcggccaaagcagcggtggaaaccggcgatatcatcatcgccaatctgctgttcctc
gaagagcattatgcccgcattcttcccagccttgaggcccgccgcccgcattgcgatgcg
atgatcggcgtgattgccgatgcctccatcgtcaagctgaccaagatgggcgcgctcgat
atgatggcgccgaaatcgggtgccatgaagctgatgaaaaagctgcgtggctcctccaaa
ccgtcgagttcatcgggggcggacaagatggcgctcctgcgccgcttgccaaaaatcctg
aagttcattccgggcaaaagccaggatttgcgcgcctggttcatgagcatgcaatactgg
ctgggtggttcggacgacaatgtagaagcgatgatgcgctttttgctcaaccgctacgcc
aggaaccccggatgggccaaggcaccagaggcccccgcgcccatcgagtaccccgatgcc
gggctttatcatcccgacctgccgacacggattaccaccgatctgaacgacctgccccgc
cccgaaggtgccacggcgacggtcgggttgttgttgatgcgctcctatgtgttgtcctcg
gatacggcgcattacgatgctgtcattcgcagctttgaagcgcgtggcattgcggtgcgc
gctgcctttgccgggggccttgatgggcgacccgcgattgatgcctatttccgcgatcag
tccggcacgcagattgacgcgatggtgtctctgaccggtttttcgctggtcggtggccct
gcctataatgacaacgacgccgccatcgcggtcctgaaagaccttgatgtgccctacctt
gccgcgcatccgcttgagtttcagacgctggagcaatgggcgtgctcgacgcaggggctt
ggacccatagagacgacgatgcttatcgcgctgcctgaacttgacggtgcaaccaacccg
accgtttttgccggtcgccacggcacagcagggtgtcacggctgcaatcatgactgtgag
atgaagtctgatcacaaggccatggccccctgcatcgaacgggtcgacagccttgtcgaa
aagaccatccgcatgaccactttgcggcgcaagaccaacgcggaaaagacgctcgggatc
gttctgtttggtttcccgcccaacgcgggggccgtgggcactgcggcgtacctcagcgtt
tttgagagcctgttcaacacgttgcaccgccttaaggccgatggttatgatgtcgaggtc
ccggaaaccgtcgatgcgctgcgcgacaaggtactcgcgggcaacgccaggcaatacggt
caggaagccaatgtcgcggatcacgtaaccgccgacaccatcgtgaaaaccacacccccg
ctggctgcgatcgaagcggtctggggcccggcacccgggcgcattcaatcggacgggcgc
ggtgtgttcatccttggtgcgcatttcggcaaggtctttgtcggcgtgcaaccggccttc
ggttacgaaggcgacccgatgcggctgctcttcgaaaaagggtttgcgccgacacatgcc
tttaccactttctatctctggctgcgcaatacactgaaagcagacgcgatcctgcatttc
ggcatgcatggcgcgctcgaattcatgcccggcaaacaggcgggccttggggcgcgtgac
tggccggatcgtctgatcggtgagatgccgaacatctacctttatgcgtcgaacaacccg
tccgaggcctcgctggccaaacgccgttccggtgcggtgaccatcacccatctgacaccg
cctctggcggcttcggggctctacaaagggcttttggacctcaaggacagcctgacccgc
tggcgcgcgatggatcaggacagcgacgagcgggacgagttgcaagccctcattgcccag
caggcggatgcggtggacatgggtgatgtcacacccgatcagctgtggctcaaactgctg
gaaaccgaagacgcgctgatcccggacggtctgcacattcttggcaaaccgctctctgat
gcggcgcgggcggaatacctcagcatcatggatcacgcagatgacgccacccgcgcgcgg
gtggatgcgctgctgcaacaggaaaccgaacttgatgcgatctgccgtgcgctttccgcg
cgctacatcgcacccgtgccgggtggcgatctgatccgctccacggatatcctgccgaca
gggcgcaatatccatgcttttgaccccttccgcatgccgacggcctttgcctgtcaggac
ggtgcgaaacaggcgcaactgttgctggatacgcatcagacgctgccgcgcaccgtggcg
ctggtgctctggggcagcgacaacatcaaatccgacggcggcccgattgcacaggcgctg
gccctgatgggatgcgtgccccgctttgacagttttggacggctcgccggagcggatctg
atttcattggaagacctcggacgtccgcgcattgatgtgatcatgacgctgtcgggtatc
ttccgtgatctcttgcccttgcagacccggatgctggctgaggccgcacagaaatgcgcc
atggccgatgaaccggttgagttgaactatatccgcgcccatgcgctggcctatgccgaa
aaaactggctgcgatatggcagaggcatccctgagggtcttctcgaacgccgagggtgct
tacggatccaacgtcaaccagctggtggacagttccgcctttggcgatgaagacgaattg
gccgatgcctatcaggcccgaaagagctttgcctatggcacagacggcaaggcgtcctcc
aatgccgcgctgctgcagtcccaactggccgaggtcgatgtggcctatcagaacctcgaa
tctgttgaactgggcgtgaccacggttgatcattatttcgacacgctgggtggcatcgcg
cgggcggttaaacgcgccaaagggtccgaggccgccgtctatatcggggatcagacccgt
ggatcgggcaaggtccgcaccctgaaagagcaagtggcacttgaaacccgcagccgcagc
ctgaacccgaaatttttcgagggcctgctgaaacacggggccgaaggcgtgcgccagatc
gaggcgcaggtgaccaatacgatgggctggtccgccaccacaggtcaggttgatccgtgg
gtttaccagcgcctctctgagacctttgtgctggatgaagacatgcgccagcgccttgct
gacctcaacccgaccgcgtcaagccgcatggccaaccgcctgcttgaagcgcacgaccgc
aactactggagccccgacgcagaaacgctggccgccctgcaggatgccgccgatgcgctg
gaagaccaacttgaagggatcgcggcacaatga

DBGET integrated database retrieval system