KEGG   Roseobacter denitrificans: RD1_0471Help
Entry
RD1_0471          CDS       T00376                                 

Gene name
hemD
Definition
uroporphyrinogen-III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
rde  Roseobacter denitrificans
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:rde00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RoseoBase: 
UniProt: 
Position
457543..458247
Genome map
AA seq 234 aa AA seqDB search
MQKIPLILTRPKGSNAVFEADIAPKVRQHVDFIHSPLLEIVPIDGGYDSTGADHAIFTSA
NGVKYAPKGNGRRAFCVGEKTTQLARSHGWDAVFAGATVLALKDHVLINRPQGEIHHYSG
VFVRGNVAEDLSVAGLRVTNIPLYEQRLLPFSAQALSVLERRAPVVVPLFSPRTAAHFAA
IAPAHPQLYVVAMSTAVADSCNEMSPARLIIAREPTAKSMALCVENLVLNHSLG
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
gtgcaaaagattccgctcatcctgacgcgaccgaaggggtcgaacgccgtcttcgaagcg
gacattgcgccaaaggtgcgccagcatgtggatttcattcacagcccgctgcttgaaatc
gtgccgattgatggagggtatgactcgacgggcgcggatcatgcaattttcacatcggcc
aatggcgtgaaatatgcgcccaagggaaacgggcgacgcgcattctgtgtcggtgagaaa
acgacgcaactggcacgttcgcatggatgggacgcggtgtttgccggtgcgaccgttttg
gcgctgaaagaccatgttctgatcaaccgtccccaaggtgaaatccatcactattcaggc
gttttcgtgcgcggcaatgtcgccgaggatttgtcggttgcgggtttgcgtgtcacgaat
atcccgctttatgagcagcgccttttgcccttttcggcgcaggcattgtcggttttggag
cgtagagcacctgttgtggtgccgcttttttcaccgcggacggctgctcatttcgcagca
atcgcaccggcgcatccacagttatatgttgtcgccatgagcacggcagtcgcggattcc
tgcaatgaaatgtcccctgcaaggctgatcattgcgcgagagcccactgcaaaatccatg
gctctctgtgtggaaaaccttgttctgaaccacagcttgggttga

DBGET integrated database retrieval system