KEGG   Roseobacter denitrificans: RD1_0585Help
Entry
RD1_0585          CDS       T00376                                 

Gene name
pncA
Definition
pyrazinamidase/nicotinamidase (EC:3.5.1.19)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
rde  Roseobacter denitrificans
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:rde00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RoseoBase: 
UniProt: 
Position
567843..568451
Genome map
AA seq 202 aa AA seqDB search
MSHALIVIDVQLDFCPGGALAVPDGDGIIAGINALMPQADAVVLTQDWHPAGHSSFATSH
KGHAPYDVIDMDYGPQVLWPHHCVQGADGARFHPDLQSDGADLILRKGYNPAIDSYSAFF
ENDHKTPTGLEGYLRSRGIEKLTLVGLAFDFCVNYSALDAAKLEFDVTVREDLCRAIDLD
GSRDAARQAMQNAGVRLETVHG
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgagccacgctttgattgtcattgacgttcaactggatttctgtccgggtggcgcactt
gccgtgccggatggggatgggatcatcgcgggcatcaacgcactcatgccgcaggcggat
gctgttgtgctgacacaggattggcacccggcgggtcactcctcctttgccacttcgcac
aaggggcatgcgccttatgacgtgatcgacatggattatggcccgcaggtgttgtggccg
caccattgtgtgcagggggctgacggcgcgcggttccatcccgatctacaaagtgacggc
gcagatctgatcctgcgcaaagggtataatccggccatagacagctattccgcgttcttt
gaaaatgatcacaaaacgccaacagggcttgaagggtaccttcgcagccggggtatcgaa
aaactgacgctggtcgggctggcattcgatttctgcgtcaactattcagcactcgatgcc
gccaaactggaattcgacgtcacagtacgcgaagatctgtgccgcgcgattgaccttgat
ggttcccgtgatgcagcgcgtcaggccatgcagaatgcgggcgtgcgtctggagacagtg
catggttga

DBGET integrated database retrieval system