KEGG   Roseobacter denitrificans: RD1_0585Help
Entry
RD1_0585          CDS       T00376                                 

Gene name
pncA
Definition
pyrazinamidase/nicotinamidase (EC:3.5.1.19)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
rde  Roseobacter denitrificans
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rde00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    RD1_0585 (pncA)
Enzymes [BR:rde01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     RD1_0585 (pncA)
    3.5.1.-  
     RD1_0585 (pncA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RoseoBase: 
UniProt: 
Position
567843..568451
Genome map
AA seq 202 aa AA seqDB search
MSHALIVIDVQLDFCPGGALAVPDGDGIIAGINALMPQADAVVLTQDWHPAGHSSFATSH
KGHAPYDVIDMDYGPQVLWPHHCVQGADGARFHPDLQSDGADLILRKGYNPAIDSYSAFF
ENDHKTPTGLEGYLRSRGIEKLTLVGLAFDFCVNYSALDAAKLEFDVTVREDLCRAIDLD
GSRDAARQAMQNAGVRLETVHG
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgagccacgctttgattgtcattgacgttcaactggatttctgtccgggtggcgcactt
gccgtgccggatggggatgggatcatcgcgggcatcaacgcactcatgccgcaggcggat
gctgttgtgctgacacaggattggcacccggcgggtcactcctcctttgccacttcgcac
aaggggcatgcgccttatgacgtgatcgacatggattatggcccgcaggtgttgtggccg
caccattgtgtgcagggggctgacggcgcgcggttccatcccgatctacaaagtgacggc
gcagatctgatcctgcgcaaagggtataatccggccatagacagctattccgcgttcttt
gaaaatgatcacaaaacgccaacagggcttgaagggtaccttcgcagccggggtatcgaa
aaactgacgctggtcgggctggcattcgatttctgcgtcaactattcagcactcgatgcc
gccaaactggaattcgacgtcacagtacgcgaagatctgtgccgcgcgattgaccttgat
ggttcccgtgatgcagcgcgtcaggccatgcagaatgcgggcgtgcgtctggagacagtg
catggttga

DBGET integrated database retrieval system