KEGG   Roseobacter denitrificans: RD1_0991Help
Entry
RD1_0991          CDS       T00376                                 

Definition
hypothetical protein
Orthology
K08738  
cytochrome c
Organism
rde  Roseobacter denitrificans
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Thiosulfate oxidation by SOX complex, thiosulfate => sulfate
Brite
KEGG Orthology (KO) [BR:rde00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    RD1_0991
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    RD1_0991
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RoseoBase: 
UniProt: 
Position
complement(956253..957581)
Genome map
AA seq 442 aa AA seqDB search
MKKQHTLFAARHGLLFGLVTCGLFLSSPTQAQEAFTLNGHGGPVKGISTQTDGTILTASF
DNSVGIWTDGTPQWLEGHEAAVNAVVPVANDQIVSAGDDYSVRLWSPQNGTVRELGRHNA
KVIRLAAAPDGQSVASASWDRTVRIWPIDGAASLLIEGHDNTVSDVAFSPDGTRVYTSSA
DGTIRVWDAQTGAFLKRLVEHGFGINTLLVAPDESWLAYGAVDGGTRLVSLPEGVDIGDF
TADRRPILAMAHSDKTDRIAIGDAQGYIMMIDSSALRITDDFQATPAGPVWALAFSPDGQ
NIHAGGISDVVHSWPVGSLDSATQMTGTTRAFMTDPDQMTNGERQFKRKCSICHTLEPDG
KRRAGPSLYGLFGRAAGAIKDYPYSPTLATSDLVWTEETVDLLFDLGPDHYIPGSKMPMQ
RITGAQDRADLISFLQSATTPE
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagcaacacaccctctttgctgcccgccatgggttgctcttcggccttgttacc
tgcggccttttcctgtcatcaccgacgcaagcgcaggaggcttttaccctcaacggccac
ggcgggccggtcaaggggatcagcacgcagaccgatggcacgatcctgaccgcaagtttc
gacaactcggtcggcatctggacagacggcacaccgcagtggctggaggggcatgaagcg
gcggtgaatgcggtcgtccccgtggccaatgatcagatcgtatccgcaggggatgactat
tcagtccggctctggtcgccgcaaaacggcacggtgcgcgaacttggcagacataatgcc
aaggtcatccgccttgccgccgccccggacgggcaaagcgtcgcctccgccagttgggac
cggaccgtgcgtatctggccgatcgacggcgcagcctcgctgctgatcgaagggcatgac
aacacggtcagcgatgtggccttttcccccgatggaacgcgcgtctataccagctcagcc
gatggcacgatccgggtctgggacgcgcaaaccggggccttcctgaaacgtctggtggaa
catggctttggcatcaacaccctgctggtcgcgcctgatgaaagctggctggcctatggt
gccgtcgacgggggaacgcggctggtctccctgcccgagggcgttgacatcggcgacttc
accgctgatcgccgccctattctggccatggcccatagcgacaagacggaccggatcgcg
attggcgacgcgcagggctacatcatgatgatcgacagcagcgccctgcgcatcaccgat
gattttcaggccacccccgccgggccggtctgggcgctggcattttcaccggacggccag
aacatccatgccggtgggatttctgacgtggtacacagttggcccgtaggcagccttgac
agtgccacgcaaatgaccggcaccacccgcgccttcatgaccgacccagatcagatgacc
aacggcgagcgccagttcaaacgcaaatgctccatctgtcacacgctggaaccggatggg
aaacggcgcgcagggccctccctttatgggctgtttggccgcgccgcgggcgcgatcaag
gattatccctactcccccacactggccacatcagacctggtctggaccgaagaaaccgtt
gatctgctgtttgaccttgggccggatcactacatccccggctccaagatgccgatgcaa
cggatcacgggcgcgcaggaccgcgccgacctgatcagctttctgcaatcggccacaacg
cccgaatag

DBGET integrated database retrieval system