KEGG   Roseobacter denitrificans: RD1_1228Help
Entry
RD1_1228          CDS       T00376                                 

Definition
acyl-CoA thioesterase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
rde  Roseobacter denitrificans
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:rde00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    RD1_1228
Enzymes [BR:rde01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     RD1_1228
   3.1.2  Thioester hydrolases
    3.1.2.-  
     RD1_1228
Lipid biosynthesis proteins [BR:rde01004]
 Fatty acid synthase
  Component type
   RD1_1228
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RoseoBase: 
UniProt: 
Position
1195596..1196234
Genome map
AA seq 212 aa AA seqDB search
MRKLIGCFVVCFPTWGAADGVVIAALGDSLTQGYGLVQEEGFVPQLQAWLDREGIAARVI
NAGVSGDTTAGGLSRVAWTLTPKVDAMIVALGGNDLLRGIDPAESRRNITGILEAAAAQS
VEVLLVGMQAPGNFGPDFKAEFDAIYPELASEFGVLYAADFFEGLSVVGGDPASVRAFMQ
PDGIHPNAQGVMRIVEALGPDVAELVAQAGSR
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaagttaatcggatgttttgtcgtttgttttccaacgtggggcgctgcggatggc
gttgtgatcgcggccctcggcgatagcctgacgcagggctatgggctggtgcaggaggag
ggcttcgtgccgcaactgcaggcctggctggacagggaaggcatcgcggcgcgggtgatc
aacgcaggtgtctcgggcgacacaacggctggcgggctgtcgcgggtggcctggaccctt
acaccaaaggtggatgcgatgatcgtggcccttggcggcaacgatcttttgcgcgggatt
gacccggccgaaagccgccgcaacatcacgggaattctggaggcggcagcggcgcagagc
gtggaggtgttgctggtgggcatgcaggcaccgggtaacttcggccccgatttcaaggcg
gaattcgatgcgatttatcctgagcttgcgtcagaattcggtgttttatacgcggcagat
ttttttgaaggtttgtccgtcgtcgggggcgatccagcgagcgtgcgggcattcatgcaa
ccggatggtattcaccccaatgcacagggtgtcatgcgcatcgttgaggcgctcgggccg
gatgtggcggaactggtggcacaagccggatcgcgatag

DBGET integrated database retrieval system