KEGG   Roseobacter denitrificans: RD1_1303Help
Entry
RD1_1303          CDS       T00376                                 

Gene name
nas
Definition
zinc metalloproteinase nas-13 (EC:3.4.24.21)
Orthology
K08076  
astacin [EC:3.4.24.21]
Organism
rde  Roseobacter denitrificans
Brite
Enzymes [BR:rde01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.21  astacin
     RD1_1303 (nas)
Peptidases [BR:rde01002]
 Metallo Peptidases
  Family M12: astacin/adamalysin family
   RD1_1303 (nas)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RoseoBase: 
UniProt: 
Position
complement(1262010..1263047)
Genome map
AA seq 345 aa AA seqDB search
MSEHDEEDCCCGGLLTSNDVRTGIISGDTFKNKTVQYAAVDGLAVFEGCIVLGTVEEVEE
RTAAAKAALDAGDDPDEIAHGVVITGANRRWPGALMPYEIDPALPATNVQRVNDAIAHWK
QKTGMRFVLRTNANKAQYPNYVRFRPATGCWSQVGMRGGKQEIGLAGGCGFGATVHEIGH
AFGLWHEQSREDRDTKVKINWQNITAGKEHNFNQHIADGDDVGPYDYGSIMHYGRYAFSK
NGQPTIESIPPGKTLGQRTGLSAGDIVAIQSIYQLWETVDVARVYATSGTKNCWVMPKGQ
GWFRIDPDTTDGCSNVFDICCSAMAFGKKLSLFKDGDKVYRAQLL
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaacatgatgaggaagattgctgctgcggaggtctgttaaccagtaacgacgtc
cgaaccggcatcatctccggcgatactttcaagaacaagacggttcaatacgcggcagtc
gatgggcttgccgtgtttgaaggctgcatcgtgcttggcacggtggaggaagtcgaagag
cgcactgcggcggccaaggctgcccttgatgcaggcgatgatccagacgagatcgcacat
ggcgtggtgatcacgggggccaatcggcgctggccgggcgcgttgatgccatatgaaatc
gacccggccctgcccgcaaccaacgtgcaacgcgtcaatgatgccatcgcccactggaaa
cagaaaaccggcatgcgctttgtgctgcgcacgaatgcgaacaaggcgcaatatcccaat
tacgtgcggtttcgccctgccacgggctgttggagtcaggtcggcatgcgcggcggcaag
caggaaatcggccttgccggtggctgcgggtttggcgcgaccgtccacgagatcggccat
gcgttcgggctctggcacgaacaaagccgggaagaccgcgataccaaggtcaagatcaac
tggcagaacatcaccgcgggcaaagagcataacttcaaccagcacattgcggatggggat
gacgtgggaccctatgactacgggtccatcatgcactatggccgctatgcgttctccaag
aacggccagccgaccattgagtcgatcccaccgggcaagacgctgggtcagcgcaccggg
ctgagtgccggtgatattgtcgccatccagagcatctatcagctatgggaaaccgtcgat
gttgcacgggtctatgcgacctcgggcacaaagaactgctgggtcatgccgaaaggtcaa
gggtggttccgcattgatccggacaccaccgatggatgcagcaatgtgttcgacatctgc
tgttcggcgatggccttcggcaagaagctgtcccttttcaaggacggcgacaaggtctac
cgcgctcaactattataa

DBGET integrated database retrieval system