KEGG   Roseobacter denitrificans: RD1_1357Help
Entry
RD1_1357          CDS       T00376                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
rde  Roseobacter denitrificans
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:rde00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RoseoBase: 
UniProt: 
Position
1306678..1307292
Genome map
AA seq 204 aa AA seqDB search
MTVPQVTRQGKIGKKSPQLRSLALIAVGSNQGLRNGTPHDTVLNALKEFPVKVGSIRAFS
RLFRTAAFPAGSGPDFVNAAFALETELDAADLLSHLHEVESLFRRNRTKRWGPRTLDLDL
IAMADQVLPDRETFDHWAQLPIDQQMTTSPERLILPHPRVHERAFVLIPLADVAPEWRHP
VRGVSVQEMVDALPENLKNEVEPL
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
ttgactgtgccgcaagtgacaagacaggggaaaattggcaaaaaatcgccacaattacgg
tcacttgcactgattgccgttgggtcaaaccaaggcttacgcaacggaaccccacacgat
accgtactgaatgcattgaaagaatttcccgttaaggttggatcgattcgggctttcagc
aggctgtttcgcacggctgccttcccggcgggatccggcccggatttcgtcaatgcggcc
tttgcccttgagacggaactggatgcagccgaccttttgagccatcttcacgaggttgaa
tcactgttcaggcgcaaccggaccaagcggtgggggccgcgcactctggaccttgatctg
atcgcgatggcggatcaggttttgcctgatcgcgagacattcgatcactgggcgcagttg
ccgatcgatcaacagatgaccacatcgccggagcggttgatcctgccgcacccgcgtgtg
catgagcgggcatttgtcctgatcccgctggcggatgtggcaccggaatggcgtcacccg
gtccgcggtgtcagcgttcaggagatggtcgatgccttgccggaaaacctcaaaaacgaa
gtcgaaccgctgtaa

DBGET integrated database retrieval system