KEGG   Roseobacter denitrificans: RD1_1416Help
Entry
RD1_1416          CDS       T00376                                 

Gene name
arcA
Definition
arginase (EC:3.5.3.1)
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
rde  Roseobacter denitrificans
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:rde01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:rde00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RoseoBase: 
UniProt: 
Position
complement(1353486..1354412)
Genome map
AA seq 308 aa AA seqDB search
MTKQKCILIGVPMDCGKRRQGCLMGPDAYRTAGLAPAIRDLGYVAEDRGNISPGAFTPDT
HDGRLYALNETIAWTRSLKEAAQVAMADGFPIFMGGDHALSLGTVAGVAAHAAGQNRPQF
VLWLDAHPDYHTPDTTDSGNLHGTPLGYLTGRGAFDGFPEVEVKVPTGNVAMIGLRSVDA
PEREAIQATDIQVADMRAIDENGIAAPLRRFLERVEAAGGMLHVSLDVDFLDPAIAPAVG
TTVPGGATLREAHLAMEMLHDSGLVTSLDLVELNPFLDERGRTASLMVELTASLLGRRVF
DRPTRSYS
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgaccaagcaaaaatgcattttaatcggcgtgccgatggattgcggcaaacgccgtcag
ggttgcctgatgggtccggatgcctatcgcaccgcggggcttgccccggccatccgtgac
ctcggatatgtggccgaagaccgcgggaatatcagccccggcgctttcacgcctgacacg
catgacggcaggctctatgccttgaacgaaacaatcgcatggaccaggagcctcaaggag
gcggcgcaggtcgccatggccgacggttttccgatcttcatggggggcgatcatgcgctc
tcgctgggcacggttgccggggttgcggcccacgccgccgggcagaaccgtccgcaattc
gttttgtggctcgatgcccatcccgactatcacacgcccgacaccaccgattccggcaat
ctgcacggcacaccgctggggtatctgaccgggcgcggggcctttgacggctttcccgag
gttgaggtcaaagtgcccaccggaaacgtcgccatgatcggcctgcgctccgtcgatgca
cccgaacgggaggcgatacaggcgaccgacattcaggtcgccgacatgcgcgcgattgat
gaaaacggcatcgccgcccccctgcgcaggtttctggaacgggtggaggcggcgggcggc
atgctgcatgtctcgctcgatgtggatttcctcgaccctgccatcgcacccgccgttggc
accaccgtgccggggggtgcgaccctgcgcgaggcccatctggcgatggagatgctgcac
gacagcggccttgtgacctcgcttgatctggtcgaactcaaccccttccttgacgaacgc
ggtcgcactgcgtcgcttatggtcgaactcaccgcgtcgcttttgggacgccgcgtattt
gaccgcccaacccgcagctattcctga

DBGET integrated database retrieval system