KEGG   Roseobacter denitrificans: RD1_1475Help
Entry
RD1_1475          CDS       T00376                                 

Gene name
mcd
Definition
(GenBank) malonyl-CoA decarboxylase
  KO
K01578  malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
rde  Roseobacter denitrificans
Pathway
rde00410  beta-Alanine metabolism
rde00640  Propanoate metabolism
rde01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rde00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    RD1_1475 (mcd)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    RD1_1475 (mcd)
Enzymes [BR:rde01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.9  malonyl-CoA decarboxylase
     RD1_1475 (mcd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MCD MCD_N
Motif
Other DBs
NCBI-ProteinID: ABG31108
RoseoBase: RD1_1475
UniProt: Q16A85
Position
complement(1399637..1400881)
Genome map
AA seq 414 aa AA seqDB search
MSYFGGLISTLFERRYQQALSDEVDSRTTCELCEALLSSHGEVSGVTLARNLLDRYAAMT
EAEKTALFGFMAHDLEIDPDAVTHTLEAYKNNPGKDTYRAFAAACEPRRQELARRLNQVP
GATGQLVQMRKDLLRMMKDHPDLEPVDVDFKHLFSSWFNRGFLVLRPIDWSSPANILEQI
IAYEAVHEIDSWDELRRRLQPSDRRCFGFFHPSMADEPLIFVEVALTEGVPSSVQDLLAD
ERDVITAQDADTAVFYSISNCQSGLAGISFGNSLIKQVVADLAKDLPGLTTFVTLSPIPG
LNRWLQDADIDALKDADTQALAAHYLLEAKRSDGMPFDPVARFHLGNGALVHAVHAEADV
SPNGRKQSNGAMVNYLYDLSQISQNHEKFVGDKIVVASTTVKALSGSVTTSLGT
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgagctatttcggcggattgatctcgaccctttttgagcggcgataccagcaggctctc
tcggatgaggtggacagccggacaacctgcgaactctgcgaagcgctgctgagcagccac
ggcgaagtttcaggtgtcacgctggcgcgcaacctgctggatcgctacgccgcaatgact
gaggcagaaaaaaccgccctttttggcttcatggcgcatgatcttgagattgacccggac
gcggtcacacacacgctggaagcctataagaacaacccgggcaaagacacatatcgtgcc
tttgccgcagcttgcgaacctcggcgtcaggaattggcgcgacgtctgaatcaggtgccg
ggggcgacgggacagttggtgcagatgcgcaaagacctgttgcggatgatgaaagaccac
cccgatctcgaacccgttgatgtggatttcaaacatctgttttcgtcatggttcaatcgc
ggctttctcgttttgcgcccgattgactggtccagcccggcgaatatccttgaacagatc
atcgcctatgaagccgtgcatgaaattgacagctgggatgaactgcggcgcaggctgcaa
ccgagcgacagacgctgctttggtttctttcacccctcaatggcggatgagccgttaatt
tttgtcgaggtcgcattgaccgagggtgtgcccagttcagtgcaggatttgctggccgat
gaacgggatgtgatcacggcgcaggacgcagacacggccgtcttctattccatctcgaac
tgccagtcggggctggcgggtatttcattcggcaactcactgatcaaacaagttgtcgct
gatctggccaaggatttgccggggcttacgaccttcgttacgctgtccccgatccccgga
ttgaacagatggcttcaggatgccgatatcgacgcgctcaaagacgccgacacgcaggcc
ctcgcagcgcactatctgctggaagccaagcgatcagacggcatgccctttgacccggtc
gcacgcttccaccttggcaatggcgctttggtccatgcagttcacgcggaggcagatgtt
tcaccgaacgggcgcaaacaatccaacggcgcgatggtcaactatctttacgacctctct
caaatctcgcaaaaccacgagaaattcgtcggtgacaagatcgtcgtcgcctccacaacc
gtcaaagcactcagcggatcagtgaccacaagtttaggaacctga

DBGET integrated database retrieval system