KEGG   Roseobacter denitrificans: RD1_1528Help
Entry
RD1_1528          CDS       T00376                                 

Definition
(GenBank) nucleoside phosphorylase, C -terminal domain, putative
  KO
K00758  thymidine phosphorylase [EC:2.4.2.4]
Organism
rde  Roseobacter denitrificans
Pathway
rde00240  Pyrimidine metabolism
rde01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rde00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    RD1_1528
Enzymes [BR:rde01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     RD1_1528
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_3 Guanylate_kin Glycos_trans_3N PYNP_C DUF2254 AAA_18 AAA_16 AAA_29
Motif
Other DBs
NCBI-ProteinID: ABG31161
RoseoBase: RD1_1528
UniProt: Q16A32
Position
1450893..1452926
Genome map
AA seq 677 aa AA seqDB search
MPGTLFLIVGPSGVGKDTLLEGARDRLATSRWFSFPQRVVTRAADAGGEDYIPVTPSEFE
QQLAAGAFWHQWHAHGLSYGIPMQVARDLDNGINVVLNASRNEIGAFRDKATHVVTIGIS
APPGIVEERLHERGRESEEEIKRRLARLVEQAPLTGYALEIVNDRTIEEGITALVDLIAG
ACDLNAEITRFPVTIGSKQVCLVHKGNQIASRVLAGSSRVTLSLRGKSVSAELGETWSDE
IVSQDLCALSEGAMAALDAVEGDVVSIERSPTPKSRSILQKKVRGGELSHAEMEAFIHDL
VNGRFSTSEIAGFLVAASNNLTMDEVISLTQVRAAFAHRHDWGKAIVVDKHSMGGVPGNR
ITPIIIPILAAFGLTVPKTSSRAITSAAGTADMMEVLSRVDLSPDEMKSVVEQTNGCIAW
NGNLTHSPVDDVMNAINRPLGLQSTLLDVSSIMSKKLAAGSTHVLIDMPVGPKAKTRTQG
EAGALKNLFESVGQGIGLNTKVQISDGTKPIGRGVGPVLEALDVLSVLRGEAGAPTDLLD
KSIGYAATILEWSGAVSQGQGAQVTRDLVSSGKAFEKLFEIRDAQGRQHDPLQPGQFTED
ICADRSGRVEAIDIQGISEVARLSGAPKDKAAGVVLNVQVGDQIAEKQPLLRVHSSSLRG
IEEAVCAAQAQSAFKIL
NT seq 2034 nt NT seq  +upstreamnt  +downstreamnt
gtgccgggtacgctgtttctcattgtcggtccaagtggcgttggcaaggacaccttgctg
gagggcgcgcgcgatcgtctggcaacgagccggtggttttccttcccgcagcgggttgtc
acgcgggccgctgatgcgggcggggaggattacattcccgtaaccccgtccgaattcgaa
cagcaactggccgccggggcgttctggcatcaatggcacgcgcatggcctgtcctacggc
atccccatgcaggtcgcgcgcgatctggacaacggcatcaacgtcgtgctgaacgcgtca
cgcaatgagattggcgcgtttcgtgacaaggcgacgcatgtcgtgaccattggaatttct
gcgccgcccggcatcgttgaagaacgccttcatgagcgcgggcgcgagagcgaagaagaa
ataaagcggcgtctggcgcgccttgtggagcaagcccccctgacaggctatgcgctggaa
atcgtgaatgacagaaccatcgaggaaggcataacagcgcttgtcgacctgatcgccggg
gcgtgcgatctgaatgcagaaatcacccgctttccggtcacgatcgggtcaaaacaggtt
tgtctggttcacaagggtaatcagatcgccagccgcgtgctggcggggtcgtcgcgggtc
acactgtctttgcggggcaaatccgtctctgcggaactgggcgaaacgtggagcgatgaa
atcgtgtcgcaagacctctgtgcgttgtccgagggcgcgatggcggcgctggacgcggtg
gagggcgatgtcgtctcaatcgagcggtcgccgacgcccaaaagccggtccatcttgcaa
aagaaagtgcgcggcggtgagttgtctcacgccgagatggaagccttcatccacgatctg
gtcaacgggcggttcagtacctcggaaatcgcggggtttcttgtcgcggcatcgaacaac
ctgacgatggacgaagtgatctcgctgacgcaggtacgtgccgccttcgcgcatcgccat
gattggggcaaggcgatcgtcgtcgacaaacactccatggggggcgtgccgggcaatcgc
atcacaccgatcatcattcccattctggcagcctttggcctgaccgtgcccaagacatca
tcgcgggccatcacttcggcggcagggacggcggatatgatggaagtgctttcgcgcgtt
gatttgtccccggacgaaatgaaatcggtcgtggaacagacaaatggctgcatcgcatgg
aacggcaacttgactcattccccggtggatgacgtcatgaatgcgataaaccggccgctg
ggcttgcaatccacattgctggatgtgtcgtcgatcatgtccaaaaagcttgcggcaggg
tccacccatgtgctgatcgacatgccggtggggccaaaagccaagacgcgcacccaaggc
gaagcgggcgcgttgaaaaacctgtttgaatcggtggggcagggcatcgggctgaacaca
aaggtgcagatatcggatggcacaaaacccatcgggcgcggggtcgggccggtgctcgag
gccttggatgtcttgagtgtattgcgtggagaggcaggcgcgccgaccgatttgctcgat
aaatccatcggctatgcggcgacgatactggaatggtccggggccgtgtcccaggggcag
ggcgcacaggtgacccgcgatctggtgtccagcggaaaggccttcgaaaagctgtttgag
atcagggatgcgcaggggcgccaacacgacccgctccagcccgggcaattcaccgaagat
atatgcgccgacagatcgggccgcgttgaggccatcgacatacaagggatttcggaagtc
gcgcgtttgtctggcgcgcccaaggacaaggccgccggcgtggttttgaacgttcaggtc
ggggatcagatcgcggaaaaacagccgctgctcagggtccattcctccagtctgcgcggg
atagaggaggcagtctgtgccgctcaggcgcagagcgctttcaaaatcctgtag

DBGET integrated database retrieval system