KEGG   Roseobacter denitrificans: RD1_1608Help
Entry
RD1_1608          CDS       T00376                                 

Gene name
sucB
Definition
dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
rde  Roseobacter denitrificans
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rde00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RD1_1608 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RD1_1608 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    RD1_1608 (sucB)
Enzymes [BR:rde01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     RD1_1608 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RoseoBase: 
UniProt: 
Position
complement(1550270..1551766)
Genome map
AA seq 498 aa AA seqDB search
MTTEVRVPTLGESVTEATVATWFKKPGEAVAVDEMLCELETDKVTVEVPSPMAGTLGEIV
AGEGETVGVNALLATISEGAAAQAPAENSAPTSAAASASVDVMVPTLGESVTEATVSTWF
KAVGDSVAQDEMLCELETDKVSVEVPAPAAGTLSEILAPEGETVAAGGKLAVLSSGDGAT
SAPAAAAATPAPAAPAASGSKDVEDAPSAKKAMAQAGLSPDQVTGTGRDGRIMKEDVSQA
IAAAASAPAPAATAPAPRAPVSADDASREERVKMTRLRQTIAKRLKDSQNTAAMLTTYNE
VDMTEVMALRNEYKDLFLKKHGVKLGFMSFFTKACCHALREVPEVNAEIDGTDIVYKNFV
HMGIAAGTPTGLVVPVIRDADAMSFHAIEQAIAEKGARARDGKLSMAEMQGGTFTISNGG
VYGSLMSSPILNPPQSGILGMHKIQDRPMAINGQVVIRPMMYLALSYDHRIVDGKGAVTF
LVRVKEALEDPRRLLMDL
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgaccactgaagtacgcgtaccaacattgggcgaatccgtcaccgaggccaccgtcgcc
acctggttcaagaagcctggtgaggctgtggccgtggacgaaatgctctgcgaattggaa
acggataaggtcacggtcgaagtgccctcgcccatggcgggcacattgggtgagatcgtg
gcaggcgaaggcgaaaccgtcggcgtcaatgcgctgcttgcgaccatttccgaaggggcg
gcagcacaggccccggctgagaattccgccccaacatcggctgccgcatccgcctccgtc
gatgtgatggtgccgacgctcggcgagtccgtgaccgaagcaacggtcagcacgtggttc
aaagccgtcggcgacagcgtggcgcaggatgaaatgctctgcgagctggagaccgacaag
gtcagcgtcgaggtccccgcccccgccgccggcaccctgagtgaaatccttgcacccgaa
ggcgagaccgtcgccgcgggaggcaaactggctgtcctgtcttcaggcgatggggccacc
tccgccccggcagcagccgccgccacacctgcccccgcagcgcccgccgcaagcgggagc
aaggacgtcgaagacgccccatccgccaagaaagccatggcgcaggccggtctgagccct
gatcaggtcaccggcacgggccgcgacgggcgcatcatgaaggaagacgtaagtcaggcc
attgctgctgcggcttcggccccagcgcctgcggcgactgcgcccgccccgcgtgcccct
gtctctgccgatgatgcaagccgcgaggagcgggtgaagatgacccgtctgcgccagacc
atcgccaagcgcctcaaggacagtcagaacaccgccgccatgctcaccacctacaacgag
gtcgacatgaccgaggtgatggccctgcgcaacgaatacaaagacctgtttctcaaaaag
cacggggtcaagctggggttcatgtccttctttaccaaggcctgctgccacgccctgcgc
gaggtgcccgaggtcaacgcagagattgatggcacggatatcgtctataagaacttcgtg
catatgggcatcgcggcgggcacgcccacgggccttgtggtgccggtcattcgcgatgcg
gatgccatgtcgttccacgccatcgaacaggcgattgccgaaaaaggcgcgcgcgcgcgc
gacggcaagctgagcatggcggaaatgcagggcgggaccttcacgatctcgaacggcggg
gtttacggctcgctgatgagttccccgatcctgaacccgccgcaatcgggcatcctaggc
atgcataaaattcaggaccgccccatggcgatcaatggccaggtcgtgatccgcccgatg
atgtatctggcgctcagctatgaccaccggatcgtcgacggcaagggtgctgtgaccttc
ctcgtgcgcgtgaaggaagcgctggaagatccacggcgcttgctgatggatttgtga

DBGET integrated database retrieval system