KEGG   Roseobacter denitrificans: RD1_1627Help
Entry
RD1_1627          CDS       T00376                                 

Gene name
sdhD
Definition
hypothetical protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
rde  Roseobacter denitrificans
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:rde00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RD1_1627 (sdhD)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RD1_1627 (sdhD)
   00650 Butanoate metabolism
    RD1_1627 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    RD1_1627 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RoseoBase: 
UniProt: 
Position
1567056..1567427
Genome map
AA seq 123 aa AA seqDB search
MSYLTDRKRAVGLGSAKSGTEHHWSMTVSSGALLILIPLFVFTFGPMLGASYDEVTAYFA
RPFPAVIAGLTIIVTFKHFAGGVQALLEDYVHGVAQKVAIVAMTCVSYAAMGFGLYAVVR
LAL
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgagctatctaaccgaccgtaagcgcgctgtgggacttggatctgccaagtcggggacg
gaacaccactggtcgatgacggtcagttcgggggcgctgctcattctcatcccgctgttc
gtctttacctttggcccgatgctgggcgcatcctacgacgaagtcaccgcctatttcgcc
cgcccgttcccggctgtgattgccggtttgacgatcattgtcacgttcaagcactttgcg
gggggcgttcaggcgctacttgaagactacgtgcacggtgtagcgcagaaggtggcgatc
gtggcaatgacatgcgtcagttatgcggccatgggttttggcctttacgcagttgtgcgg
ctcgcattgtaa

DBGET integrated database retrieval system