KEGG   Roseobacter denitrificans: RD1_1741Help
Entry
RD1_1741          CDS       T00376                                 

Gene name
pcm
Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
rde  Roseobacter denitrificans
Brite
Enzymes [BR:rde01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     RD1_1741 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RoseoBase: 
UniProt: 
Position
1669444..1670097
Genome map
AA seq 217 aa AA seqDB search
MADFLSRRTMMVDTQVRPSDVTKFPIIDAMLTIPREEFVPAAQREAAYLGENLPIGGHRV
ILEPRTLAKMLDALDVSVDELVLDVGSALGYSAAVIARMAEAVVAVEEDEALASEAQEAL
SAAGVDNVILHVAPLAEGAAQHGPYDVMLVQGGVVEFPQTLADQLNEGGRVACIFMVGAL
GEVRIGRKQNGKISWRMAFNAGAPVLPGFEKAAAFQF
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atggccgactttttatcacgacgcacgatgatggtggacacgcaggtgcgcccgtccgat
gtgacaaagttcccaatcatagatgcgatgctgaccatcccgcgcgaggaatttgtacct
gctgcacaacgcgaggcggcctatctgggcgaaaacctcccaatcggcggtcaccgggtg
atccttgaacccagaacgctggccaagatgctggatgcgcttgatgtatctgtggatgaa
ctggttctggatgtggggtcggcactggggtattcggcagcggtcatcgcgcgcatggcc
gaggcggttgtcgcggtcgaggaagacgaagcgctggcgtcagaggcacaggaagccctg
agtgctgcgggtgtcgacaacgtgatcttgcatgttgcgccactggccgaaggggctgca
cagcacggtccctatgatgtgatgctggtgcagggcggcgtggttgaattcccccagaca
ttggccgatcaactcaatgagggcgggcgtgttgcctgtatcttcatggtgggcgctctg
ggcgaggtgcgcattgggcgcaagcaaaatgggaaaataagctggcggatggcgtttaat
gcaggtgcgcccgttctgcccggctttgaaaaggctgcggcatttcagttttag

DBGET integrated database retrieval system