KEGG   Roseobacter denitrificans: RD1_1819Help
Entry
RD1_1819          CDS       T00376                                 

Gene name
pldB
Definition
lysophospholipase (EC:3.1.1.5)
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
rde  Roseobacter denitrificans
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:rde00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    RD1_1819 (pldB)
Enzymes [BR:rde01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     RD1_1819 (pldB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RoseoBase: 
UniProt: 
Position
complement(1744282..1745160)
Genome map
AA seq 292 aa AA seqDB search
MSTSDDIRIRVSHWPLQAARGTVLIFPGRTEYIEKYGQIAKALGARGLASTAVDWRGQGL
ADRLLDDPVIGHVQHFTDYQKDVAAMMRAARALGLPRPFYLLAHSMGGAIGLRAVIEGLP
VSAVAFSGPMWGIKIAPHLKPAAWILSHAMPRIGQGHRLPPGTKMEHHVLTDGFDDNVLT
RDPAQFEIMRQQLIAHPELTLGGPSYVWLREALLETRHLASRAAPDLPCITLLGSNERIV
DISAIHTRMQSWKSGHLEIVPEAEHEVLMESAQVTTGLFDQITDLFLGTDRV
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgacatcggatgatatccgcatccgtgtgagccattggcccctgcaagcggccagg
ggcacggtgctgatttttccggggcggacggagtacattgaaaaatacggccagatcgcc
aaggcgctcggcgcgcgcggtctggcgagcaccgccgtggactggcggggtcagggcctt
gcggaccgtctgcttgatgatccggtgatcgggcatgtgcagcatttcacagattaccaa
aaggatgtcgcggccatgatgcgggcggcgcgcgcgttgggcctgccccgaccgttttat
ctgcttgcgcattcaatgggcggggcgatcgggctgcgcgcggtgattgagggcctcccc
gtcagtgctgttgcattcagcggcccgatgtgggggatcaagatcgccccccacctcaaa
cccgccgcctggatactgagccatgccatgccgcgcatcggtcagggccacaggctgccg
ccgggcacgaaaatggaacaccacgtgctcaccgacgggtttgacgacaacgtactgacc
cgcgatccggcacagttcgagatcatgcgccagcagttgatcgcccatccggaactgacg
ctgggtggtcccagctatgtctggctgcgtgaagcactgttggaaacacgccaccttgcc
agccgcgcggcacccgacctgccctgtatcacgctgctgggcagcaatgaacgtattgtc
gatatctccgctattcacacgcgcatgcaaagctggaaaagcgggcatctcgaaatcgta
ccggaggcagagcacgaagtcctgatggaaagcgcgcaggtgacaacggggttgttcgat
cagataaccgacctgtttcttggaacagacagggtttag

DBGET integrated database retrieval system