KEGG   Roseobacter denitrificans: RD1_1875Help
Entry
RD1_1875          CDS       T00376                                 

Gene name
folA
Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
rde  Roseobacter denitrificans
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:rde00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:rde00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RoseoBase: 
UniProt: 
Position
1793869..1794348
Genome map
AA seq 159 aa AA seqDB search
MITLIVARAENGAIGRDGTIPWDIPEDLKFFQRETLGGALIMGRNTWESLPVKPLPRRFN
IVVSSNSDIAEVVAPSVETAIEIAKAQDHQRIYGIGGASIYAEMLPLAHRLLISEVQLQV
PDADTFFPHVDLAEWHQIDRRSLRESDPACFVVEHLRRD
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgatcacgcttattgtggcacgcgctgaaaacggcgcgatcggtcgagacgggacaatt
ccatgggacattcccgaggacctcaagttttttcagcgcgaaacccttgggggggcgttg
atcatgggacgcaacacctgggagagcctgccggtcaaacctttgccccgacgtttcaat
atcgtggtatcgtcgaattcggatatcgccgaagtggtcgcgccaagtgtcgagacggca
attgagattgcaaaagcacaagaccaccagcgcatctatggtatcggcggcgcgtctatc
tacgcagaaatgctgccgcttgcccatcgactcctcatctcggaagttcagcttcaggtg
ccagacgcggatacttttttcccgcacgtcgacttggccgaatggcaccagatcgacagg
cgatccctgcgcgagagcgatcctgcgtgttttgtggttgaacatttgagacgagactga

DBGET integrated database retrieval system