KEGG   Roseobacter denitrificans: RD1_2089Help
Entry
RD1_2089          CDS       T00376                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
rde  Roseobacter denitrificans
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:rde03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RoseoBase: 
UniProt: 
Position
1995362..1996018
Genome map
AA seq 218 aa AA seqDB search
MIGKITGRLEYRASDHVLIDVRGVGYLVFCSERTLAALPGVGEVVALYTDLLVREDVMQL
FGFTTLTEKEWHRLLTSVQGVGAKASLAILGTLGADGVSRAIALGDWNAVKAAKGVGPKI
AQRVVLDLKDKAPSVMGMSDTQATVAAQSSDAVIETRAAPSPVVQNPSAQAEALSALSNL
GYAPGDAAAAVAQAAGELPDAETPDLIRAALKRLAPKG
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgattggcaagatcacgggccgacttgaataccgcgcgagcgatcatgtgctgattgat
gtgcgcggggtcgggtatctggtcttttgctcggaacgtacattggcggctctgccgggt
gtgggcgaggttgtcgcgctatatacggacctgctggtgcgcgaggacgtgatgcagctt
ttcggtttcaccacgttgacggaaaaggaatggcaccggctgctgacctctgtgcagggg
gtcggggccaaggcgtcgcttgcgatcctcggcaccttgggagcggatggcgtcagccgg
gccattgcgctgggggactggaacgcggtcaaggcggccaagggggtcggtccaaagatc
gcccaacgcgtggttctggacctcaaggacaaggcccccagcgtgatgggtatgagcgac
acgcaagccacggtggctgctcagtcgtcagatgcggtcatcgaaacgcgcgccgcacca
agccccgttgtccaaaacccgtcggcgcaggctgaggccctgtcggcgctatccaatctg
ggttatgctccgggtgatgcggccgccgccgtggcgcaggcggcaggtgagttgcccgac
gcagaaacgcccgatctgatccgggcggcattgaaacggctcgcccccaaaggttag

DBGET integrated database retrieval system