KEGG   Roseobacter denitrificans: RD1_2141Help
Entry
RD1_2141          CDS       T00376                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
rde  Roseobacter denitrificans
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rde00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RD1_2141 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RD1_2141 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    RD1_2141 (thrC)
Enzymes [BR:rde01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     RD1_2141 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RoseoBase: 
UniProt: 
Position
2038965..2040347
Genome map
AA seq 460 aa AA seqDB search
MQYISTRGTAPVLNFEEAMLSGLARDGGLYVPQTIPQLSAEAISAMEGQPYEEIAYRVMR
PFVGEVFTDTEFREIIARAYAVFGHDARAPLKQLDQGHFLLELFHGPTLAFKDFAMQLIG
QMFQTALGRKNERVTIVGATSGDTGSAAIEAFRGLSNVDVFIMYPHGRISEVQRRQMTTP
GESNVHALAVDGDFDDCQARLKDMFNDFEFRDTVRLAGVNSINWGRVLAQVVYYFSAAVA
LGAPHRQISFTVPTGNFGDVFAGYIAKRMGLPIDKLVVATNQNDILHRCLSGQGYHKGET
VPSISPSMDIQVSSNFERALFDAYDREAPAIVQLMDELKAGGFDVSQGAMQVLQSHYASG
RASEEETSATITRALKHSGELLCPHSAIGVKVAEEQRVIGTPMVTLATAHPAKFPAAVEA
ASGVHPPLPARMADLYDRTERVTRVPNDLAALKDHIKGHI
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgcagtatatctcgacccgtggcacggcccctgtgctgaatttcgaagaggcgatgttg
agcggccttgcccgtgacggcggcctctatgtgccccagacgatcccgcagctgtcggcc
gaagccatcagcgcgatggagggtcagccttatgaggagatcgcctacagggtgatgcgc
ccctttgtcggggaggtgttcacggacacggagttccgcgagatcatcgcgcgcgcttat
gcggtctttggccatgatgcacgcgcgcccttgaaacagctggatcagggtcatttcctg
ctggagctgtttcacgggccgacgctggccttcaaggattttgcgatgcagttgatcggt
cagatgttccagaccgcattggggcgcaagaacgaacgcgtgacgattgtgggggccaca
tccggtgacaccggctccgctgcaatcgaggccttccggggtctgagcaacgtggatgtg
ttcatcatgtatccccatggccgcatttcagaggtccagcgccgccagatgactacaccg
ggcgaaagcaatgtgcatgcgctcgccgtggatggtgattttgacgactgtcaggcgcgt
ctgaaggacatgttcaatgatttcgaattccgcgataccgtgcgccttgccggggtgaat
tcgatcaactggggccgggtgcttgcgcaggtggtctattacttttcagccgccgttgcg
cttggcgcgccgcaccgccagatcagctttaccgtgcccaccggaaatttcggggacgtc
tttgccggctatatcgccaagcggatgggcttgccgattgacaagctggtggtggccacc
aatcagaacgatattctgcaccggtgcttgagcgggcagggctatcacaagggcgaaacc
gtgccctcgatcagcccgtcgatggacattcaggtcagttcaaactttgaacgcgcgctc
tttgacgcctatgaccgtgaggcacccgccatcgtccagctgatggatgagttgaaggcc
ggcggctttgacgtcagccagggagcgatgcaggtcctgcaatcgcattatgcgtccggt
cgcgcctccgaagaggaaacgtcggcgaccatcacgcgcgcgctgaaacacagcggagag
ttgctgtgcccgcattctgccattggcgtcaaggtcgccgaagagcagcgcgtaatcggc
acgcccatggtcacgctggcaaccgcccatccggccaaattccccgcagccgtcgaggcg
gcatccggcgtacacccgcccttgcctgcgcgcatggcggacctgtatgaccgcaccgaa
agggtgactcgcgtgccaaacgatctggccgccctcaaagaccacataaaagggcacatc
tga

DBGET integrated database retrieval system