KEGG   Roseobacter denitrificans: RD1_2141Help
Entry
RD1_2141          CDS       T00376                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
rde  Roseobacter denitrificans
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rde00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RD1_2141 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RD1_2141 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    RD1_2141 (thrC)
Enzymes [BR:rde01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     RD1_2141 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RoseoBase: 
UniProt: 
Position
2038965..2040347
Genome map
AA seq 460 aa AA seqDB search
MQYISTRGTAPVLNFEEAMLSGLARDGGLYVPQTIPQLSAEAISAMEGQPYEEIAYRVMR
PFVGEVFTDTEFREIIARAYAVFGHDARAPLKQLDQGHFLLELFHGPTLAFKDFAMQLIG
QMFQTALGRKNERVTIVGATSGDTGSAAIEAFRGLSNVDVFIMYPHGRISEVQRRQMTTP
GESNVHALAVDGDFDDCQARLKDMFNDFEFRDTVRLAGVNSINWGRVLAQVVYYFSAAVA
LGAPHRQISFTVPTGNFGDVFAGYIAKRMGLPIDKLVVATNQNDILHRCLSGQGYHKGET
VPSISPSMDIQVSSNFERALFDAYDREAPAIVQLMDELKAGGFDVSQGAMQVLQSHYASG
RASEEETSATITRALKHSGELLCPHSAIGVKVAEEQRVIGTPMVTLATAHPAKFPAAVEA
ASGVHPPLPARMADLYDRTERVTRVPNDLAALKDHIKGHI
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgcagtatatctcgacccgtggcacggcccctgtgctgaatttcgaagaggcgatgttg
agcggccttgcccgtgacggcggcctctatgtgccccagacgatcccgcagctgtcggcc
gaagccatcagcgcgatggagggtcagccttatgaggagatcgcctacagggtgatgcgc
ccctttgtcggggaggtgttcacggacacggagttccgcgagatcatcgcgcgcgcttat
gcggtctttggccatgatgcacgcgcgcccttgaaacagctggatcagggtcatttcctg
ctggagctgtttcacgggccgacgctggccttcaaggattttgcgatgcagttgatcggt
cagatgttccagaccgcattggggcgcaagaacgaacgcgtgacgattgtgggggccaca
tccggtgacaccggctccgctgcaatcgaggccttccggggtctgagcaacgtggatgtg
ttcatcatgtatccccatggccgcatttcagaggtccagcgccgccagatgactacaccg
ggcgaaagcaatgtgcatgcgctcgccgtggatggtgattttgacgactgtcaggcgcgt
ctgaaggacatgttcaatgatttcgaattccgcgataccgtgcgccttgccggggtgaat
tcgatcaactggggccgggtgcttgcgcaggtggtctattacttttcagccgccgttgcg
cttggcgcgccgcaccgccagatcagctttaccgtgcccaccggaaatttcggggacgtc
tttgccggctatatcgccaagcggatgggcttgccgattgacaagctggtggtggccacc
aatcagaacgatattctgcaccggtgcttgagcgggcagggctatcacaagggcgaaacc
gtgccctcgatcagcccgtcgatggacattcaggtcagttcaaactttgaacgcgcgctc
tttgacgcctatgaccgtgaggcacccgccatcgtccagctgatggatgagttgaaggcc
ggcggctttgacgtcagccagggagcgatgcaggtcctgcaatcgcattatgcgtccggt
cgcgcctccgaagaggaaacgtcggcgaccatcacgcgcgcgctgaaacacagcggagag
ttgctgtgcccgcattctgccattggcgtcaaggtcgccgaagagcagcgcgtaatcggc
acgcccatggtcacgctggcaaccgcccatccggccaaattccccgcagccgtcgaggcg
gcatccggcgtacacccgcccttgcctgcgcgcatggcggacctgtatgaccgcaccgaa
agggtgactcgcgtgccaaacgatctggccgccctcaaagaccacataaaagggcacatc
tga

DBGET integrated database retrieval system