KEGG   Roseobacter denitrificans: RD1_2244Help
Entry
RD1_2244          CDS       T00376                                 

Gene name
cheB
Definition
chemotaxis response regulator protein-glutamate methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
rde  Roseobacter denitrificans
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:rde00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    RD1_2244 (cheB)
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    RD1_2244 (cheB)
Enzymes [BR:rde01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     RD1_2244 (cheB)
Two-component system [BR:rde02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   RD1_2244 (cheB)
Bacterial motility proteins [BR:rde02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    RD1_2244 (cheB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RoseoBase: 
UniProt: 
Position
2148669..2149796
Genome map
AA seq 375 aa AA seqDB search
MHSDTNEHQSHVPAKKVLIVDDSRVIRMWLRTVLASDRRLEVVGEASDAVEARDYIRANP
ADVITLDIEMPGMSGLEFLTRLMRARPMPVVMLSSLTSKGSDAAVQALSRGAIDCILKPT
DGYDLDLSRDICERVYQAACTRPASLKRGEATEKPADAPMMQRASALGQPCRRGSLILIG
ASTGGVSALEAVLPKLDPDGAPVVIVQHMPGNFLESFSQRLDRQLPQNVKLAEEGVPLRR
GDVILAPGIGKHTEVVRRMDGWQCRFVANDPAALHCPSVDTLFLSAVSEAKKVSVAILTG
LGKDGAQGMLKLAEAGATTFGQDEETSVVYGMPRVAFGLGAVQHQLPIHKIGEALRESKN
ASARTARRTTKVPLQ
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
ttgcacagcgatacgaacgagcatcaatctcacgtaccggccaagaaggtcttgattgtt
gacgattcgcgtgtgatccggatgtggctgcgcacagtattggcctcggacagacgccta
gaagttgtcggggaggcaagcgatgccgttgaagcgcgcgattacatccgcgccaatccg
gccgacgtcataacgctggacatcgaaatgccggggatgagcggtctggagtttttgacg
cgcctgatgcgcgcgcgccctatgccggttgtcatgctgtccagcctgacaagcaaaggc
agcgatgcggctgttcaggcgctttcacgcggtgcgatcgactgtattttgaaaccgaca
gatgggtatgaccttgatctttcgcgcgacatttgtgagcgggtctatcaggcggcctgc
acgcgtccggcttccctgaaaaggggcgaggcgacagaaaaaccagcagatgcgcccatg
atgcagcgcgcttccgcgctgggtcagccttgtcgcagggggtcgctgatcttgattggc
gcatcaacaggcggcgtgtcagccttggaagccgtgttgccaaagcttgaccctgacggt
gcacccgtcgtcatcgttcagcacatgcccggtaactttcttgaaagcttttcccaaagg
ctggacagacaactgccgcagaacgtgaaactcgccgaagaaggcgtgccgctgcgtcgg
ggtgatgtgatcctagcgcccgggatcggaaaacacacggaagtcgtaaggcgcatggat
ggctggcagtgtcggtttgttgcgaatgatcccgccgccttgcactgcccatcggttgat
accctgtttttatccgctgtttccgaagctaaaaaagtgtccgttgcgatcctgacaggt
ctggggaaggatggtgcgcaaggcatgttgaaattggcagaggctggtgccaccacattc
ggccaggatgaggaaacatccgtggtttacggcatgccgcgcgtcgctttcggtctgggc
gctgtccagcatcaactgccaatccacaaaatcggtgaagcgctgcgagagagcaagaac
gcatcggcacgaacagcgcgcagaacgaccaaggtacctttgcaatga

DBGET integrated database retrieval system