KEGG   Roseobacter denitrificans: RD1_2419Help
Entry
RD1_2419          CDS       T00376                                 

Gene name
rbsK
Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
rde  Roseobacter denitrificans
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:rde00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    RD1_2419 (rbsK)
Enzymes [BR:rde01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     RD1_2419 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RoseoBase: 
UniProt: 
Position
2307806..2308828
Genome map
AA seq 340 aa AA seqDB search
MTPDLITVGGLTVDNVVAADGTVALDVAGGNGAFSAAGALNWVRRVGLVSCAVASYPKET
IARLEAGGVDLSGVIWRDATLSAGSWFLYDDSGRREEGLTAPGAALAEAGFPTDRLSPAQ
KAAWRSMLRDHAQPDEIGYSEFRVLHPLTAAQVPASWGDAPGVHLAPSALAVVGEMLEFF
AGKGGVITADPGWQLADLSLDELGPVLARLDAFLPSEVELRALVPGASVSDALAEVAARF
SGALVVKMGPKGALVWDRSAGQPIDVPAIKVATRDPTGAGDSFCGGFLAGLVESGDPVQA
AHFGAISAARTVSTFGASNALPEDATLARAALQQEASLCP
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
gtgacgcctgatctgatcacggtcggcgggcttacggtggacaatgtcgtcgctgctgac
ggcacggtcgcgttggatgtggcggggggcaacggggcattctctgccgcaggcgcgctc
aactgggtgcgccgggtcgggttggtcagctgtgcggtggcgagctatcccaaagaaacc
atcgcgcggctggaggcagggggcgtcgatctctccggtgtgatctggcgtgacgcgacc
ttgtctgcgggcagttggtttctctatgatgattccggccggcgggaagaggggctgacc
gcgccgggcgctgcactggccgaggcgggttttccgacggaccggctgtcgcccgcgcaa
aaggccgcgtggcgcagcatgctgcgggatcatgcgcaaccggacgagattgggtattca
gagtttcgtgtgttacaccccttaactgcggcgcaggtgcccgcgtcatggggcgatgcg
ccgggtgtccatctggccccgagtgcgctggcggtcgtcggcgagatgctggaattcttt
gccgggaaaggtggcgtgataacagcggatcccggctggcagttggccgacctttcgctg
gatgaacttggcccggtcctcgcgcggctggacgcctttctgccgagcgaagtcgaactg
cgtgccctcgtgcccggcgcgtcggtctctgatgcactggcggaagtggccgcgcgtttt
tccggtgccctcgtggtcaagatgggaccaaagggcgcgctggtctgggaccgcagcgcg
ggccagccgatcgacgtgccagccatcaaggtggcgacacgcgatccgacgggggcaggc
gacagtttttgcggtggctttctggccggattggtggaaagtggcgacccggtgcaggcg
gcacactttggcgcgatttccgccgcccgaacggtgagcacattcggcgcctcaaacgcg
ttgcccgaagatgcgaccctcgcgcgcgccgcattgcaacaggaagccagtctatgccct
tga

DBGET integrated database retrieval system