KEGG   Roseobacter denitrificans: RD1_2684Help
Entry
RD1_2684          CDS       T00376                                 

Gene name
glsA
Definition
glutaminase A (EC:3.5.1.2)
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
rde  Roseobacter denitrificans
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:rde00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:rde00330]
Metabolism; Metabolism of other amino acids; D-Glutamine and D-glutamate metabolism [PATH:rde00471]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RoseoBase: 
UniProt: 
Position
2558058..2558963
Genome map
AA seq 301 aa AA seqDB search
MLEKIIESIAAEIRQQDDWGETAQYIPELATVDPKQFAISVCLADGRMISAGSATKPFSI
QSISKVFALVAALGRVGNQLWSRTGREPSGTSFDSMVLLERENGRPRNPFINAGAIVTTD
ALLCGRPPKQALAEILGLVRQMSGSNGIFINDAVAASEQRTGSRNKALAYYLQSHGNLVN
DPDLTLGTYFHQCAIEMTTEQLAMAGRSLAGLEGAPRVISLKHVRRVNALMMTCGHYNGS
GDFAFRVGLPGKSGVGGGILIIAPKVASIAIWSPGLNHYGNSYAGTRAAEMLSKATNWSV
F
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
gtgttggaaaaaatcattgaatccatcgccgcagagatacgccagcaagacgactggggt
gaaaccgcgcaatacatcccggaacttgcgacagttgatccaaagcaattcgccatcagc
gtatgtttggcggacggccggatgatcagtgccggatcggcgacaaaaccattttccatt
cagagcatctccaaggtctttgcacttgtcgctgcacttgggcgggtcgggaaccagctt
tggagccgcaccggacgcgaaccgtcaggcacgtcctttgattccatggtcctgctggag
cgggagaatggccgcccccgcaacccttttatcaatgccggtgcaatcgtcacgacagat
gccctgctgtgcggacgtccgcccaaacaggcgctggccgaaattcttgggcttgtcaga
cagatgtccgggtccaacggcatcttcatcaacgacgctgttgcggcttccgagcaaaga
acggggtcgcgcaacaaagcgcttgcctattaccttcagtcccatggaaaccttgtgaat
gacccggacctgacgcttggcacatattttcaccaatgcgcaatcgagatgacgacagag
caactggcgatggccggtcggtcgctggctggccttgagggcgcaccaagggtcatatcg
ttgaaacacgttcgacgggtcaatgcgcttatgatgacctgcgggcactataacggctcg
ggcgattttgccttccgcgtcggactgccgggcaaaagcggcgtcggcgggggcatcctg
atcatcgcgcccaaagtcgcatccattgcaatctggtcgccgggtctgaaccactatggc
aattcctatgccggcacacgcgcggcggaaatgctctccaaggcaaccaattggtcggtg
ttttga

DBGET integrated database retrieval system