KEGG   Roseobacter denitrificans: RD1_2749Help
Entry
RD1_2749          CDS       T00376                                 

Gene name
hemB
Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
rde  Roseobacter denitrificans
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rde00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    RD1_2749 (hemB)
Enzymes [BR:rde01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     RD1_2749 (hemB)
Exosome [BR:rde04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RD1_2749 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RoseoBase: 
UniProt: 
Position
2620395..2621393
Genome map
AA seq 332 aa AA seqDB search
MRPTQAPFPATRLRRLRQSPAIRALTRQNTLTVDDFIWPVFVRAGEGIKEEIPSMPGVFR
RSVDQLVEAAREAADLGIPAICIFPYTGIEERTEDCAGAWDPENHVNRAIRAIKQAVPDI
AVMTDVALDTYNINGHDGFVENGEIVNDRTVEALVKMTLAQAEAGADIIGPSDMMDGRIG
AMREGLEAAGHQRVMILSYSAKYASAFYGPFRDAVGASGALSGDKKTYQMDPGNSDEALR
LIERDLREGADMVMVKPGMPYLDICRRVKDAFGAPTYAYQVSGEYAMIQSAAANGWIDGD
KVMMESLMAFKRAGCDGILTYFAPAAARILNP
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgcgcccgacacaagccccctttcccgccacccgtctgcgccgcctgcgccaaagcccg
gccatccgtgctttgacgcggcagaacacgcttacggtggatgattttatctggccggtt
ttcgtgcgcgccggtgaggggatcaaggaggagatcccctcgatgccgggtgtctttcgc
cggtcggtcgatcaactggtggaggctgcgcgcgaggcggcagatctgggcatccccgcg
atctgcatctttccctataccggcatagaagagcgtacagaggattgcgcgggcgcgtgg
gatccggaaaaccacgtcaatcgggccatccgcgccatcaaacaggcggtgccggatatt
gcggtgatgaccgatgtggcgctggatacctataacatcaacgggcatgacggctttgtc
gaaaacggagagatcgtcaacgaccgcacggtcgaggcgctggtcaagatgacgctggcg
caggctgaggcgggcgcggatatcatcggcccgtcggatatgatggatgggcggatcggt
gcgatgcgcgaaggacttgaagcggcggggcatcagcgggtcatgatcctgagctattcg
gcgaaatatgcctccgccttttacggacccttccgcgatgcggtgggggcatccggtgcc
ttgagcggtgacaagaagacctaccagatggaccccggcaattccgatgaagccctgcgt
ctgatcgaacgcgatctgcgcgaaggggcggatatggtcatggtcaaacccggcatgccc
tatctcgacatctgccgccgggtcaaagatgcctttggggcgccgacctatgcctatcag
gtgtcgggcgaatacgcgatgatccagagtgcggcggccaatggctggatcgacggggac
aaggtcatgatggaaagcctgatggcgttcaaacgcgcgggctgtgatggcattctgacc
tattttgccccggcagcggcacgtatcctcaacccgtag

DBGET integrated database retrieval system