KEGG   Roseobacter denitrificans: RD1_2749Help
Entry
RD1_2749          CDS       T00376                                 

Gene name
hemB
Definition
(GenBank) delta-aminolevulinic acid dehydratase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
rde  Roseobacter denitrificans
Pathway
rde00860  Porphyrin and chlorophyll metabolism
rde01100  Metabolic pathways
rde01110  Biosynthesis of secondary metabolites
rde01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rde00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    RD1_2749 (hemB)
Enzymes [BR:rde01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     RD1_2749 (hemB)
Exosome [BR:rde04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RD1_2749 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD AP_endonuc_2 TP_methylase
Motif
Other DBs
NCBI-ProteinID: ABG32281
RoseoBase: RD1_2749
UniProt: Q165R2
Position
2620395..2621393
Genome map
AA seq 332 aa AA seqDB search
MRPTQAPFPATRLRRLRQSPAIRALTRQNTLTVDDFIWPVFVRAGEGIKEEIPSMPGVFR
RSVDQLVEAAREAADLGIPAICIFPYTGIEERTEDCAGAWDPENHVNRAIRAIKQAVPDI
AVMTDVALDTYNINGHDGFVENGEIVNDRTVEALVKMTLAQAEAGADIIGPSDMMDGRIG
AMREGLEAAGHQRVMILSYSAKYASAFYGPFRDAVGASGALSGDKKTYQMDPGNSDEALR
LIERDLREGADMVMVKPGMPYLDICRRVKDAFGAPTYAYQVSGEYAMIQSAAANGWIDGD
KVMMESLMAFKRAGCDGILTYFAPAAARILNP
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgcgcccgacacaagccccctttcccgccacccgtctgcgccgcctgcgccaaagcccg
gccatccgtgctttgacgcggcagaacacgcttacggtggatgattttatctggccggtt
ttcgtgcgcgccggtgaggggatcaaggaggagatcccctcgatgccgggtgtctttcgc
cggtcggtcgatcaactggtggaggctgcgcgcgaggcggcagatctgggcatccccgcg
atctgcatctttccctataccggcatagaagagcgtacagaggattgcgcgggcgcgtgg
gatccggaaaaccacgtcaatcgggccatccgcgccatcaaacaggcggtgccggatatt
gcggtgatgaccgatgtggcgctggatacctataacatcaacgggcatgacggctttgtc
gaaaacggagagatcgtcaacgaccgcacggtcgaggcgctggtcaagatgacgctggcg
caggctgaggcgggcgcggatatcatcggcccgtcggatatgatggatgggcggatcggt
gcgatgcgcgaaggacttgaagcggcggggcatcagcgggtcatgatcctgagctattcg
gcgaaatatgcctccgccttttacggacccttccgcgatgcggtgggggcatccggtgcc
ttgagcggtgacaagaagacctaccagatggaccccggcaattccgatgaagccctgcgt
ctgatcgaacgcgatctgcgcgaaggggcggatatggtcatggtcaaacccggcatgccc
tatctcgacatctgccgccgggtcaaagatgcctttggggcgccgacctatgcctatcag
gtgtcgggcgaatacgcgatgatccagagtgcggcggccaatggctggatcgacggggac
aaggtcatgatggaaagcctgatggcgttcaaacgcgcgggctgtgatggcattctgacc
tattttgccccggcagcggcacgtatcctcaacccgtag

DBGET integrated database retrieval system