KEGG   Roseobacter denitrificans: RD1_2865Help
Entry
RD1_2865          CDS       T00376                                 

Gene name
rafA
Definition
alpha-galactosidase (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
rde  Roseobacter denitrificans
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:rde00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    RD1_2865 (rafA)
  Lipid metabolism
   00561 Glycerolipid metabolism
    RD1_2865 (rafA)
   00600 Sphingolipid metabolism
    RD1_2865 (rafA)
Enzymes [BR:rde01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     RD1_2865 (rafA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RoseoBase: 
UniProt: 
Position
2734352..2736436
Genome map
AA seq 694 aa AA seqDB search
MTECWRLDDARQTLALASTNGRCPQVIYWGAPLPPGEDLCALSDVSTLDVTGGMLDQNPD
LSLCPEAARSFPGQPGLIVRDRDGTPFLPKFRLDHVTQSELTLTVTCVDAPHGLTYVAEF
TLDADTHVIAMTARLSADRPLHLDWLAAPVLPAPQHSEAMIDFAGRWCGEFQMNRTPWSP
GIRMRENRTGRTGHEHFPGLIVPCKGARNTAGEAYAFHYGWSGGHRMIAEELPDGRRQIQ
FGHAAGTHMTPATEFQTAPIYAVYSCEGLNGCAVPFQRHVRDRIVAWTDTGRPRPVHYNC
WEAVYFNHDLAVLKDIASRAAALGAERFVLDDGWFGQRDDDTSSLGDWAVDTRKYPEGLD
PLIAHVRAQGMGFGIWFEPEMINPDSDTYRAHPDWALGPADQILGRQQKLLNMALPQVRD
YLYDRIAALLTAHPIDYIKWDHNRVLPMPDAAQTDGSYALIDRLRADFPQVEIESCASGG
GRIDFGILQRSQRVWLSDSNDALERLRIQHNAALFLPACVTGSHVGPRRCHTSGRVLDIA
LRAWVAAQRHMGFEMDPRELTEREAEVLRDVTGWWKDNRDWMEHADILRLDSSDPAVIAE
QQLARDGRQFVAFVGKSGTSDQIAPRPLRLTRLDPDARYAVSLRNRADAPHLSRGSLALK
DGPVTLSGAALMQHGVTLPWSFPDFIWVLEGRRL
NT seq 2085 nt NT seq  +upstreamnt  +downstreamnt
gtgacagagtgctggcggctggatgacgcgcgccagacgctggcgcttgcctcgacaaat
gggcggtgcccgcaggtcatttactggggcgcgcccctgccaccgggcgaagacctgtgc
gcgctcagcgatgtcagcacgctcgatgtgacgggtggcatgctggatcagaacccggat
ctgtcgctctgccctgaggctgcacgcagcttcccgggccagcccggtctcattgtgcgt
gaccgggacggcacgcctttcctgccgaaattccggctggatcacgtgacacagtccgag
ctgaccttgaccgttacctgcgtcgatgcgccccacgggctgacctatgtggccgaattc
acgctggatgccgacacccatgtgattgccatgacagcacggttatctgctgaccgcccg
ctgcatctggactggctggcggcccccgtcctgcccgccccgcagcacagcgaggcgatg
attgatttcgcaggccgctggtgtggtgagtttcagatgaaccgcacgccatggtcgccg
ggcatccgcatgcgcgaaaaccgcacggggcgcacgggccacgaacatttccccggtctg
atcgtgccctgcaagggggcgcgcaataccgcaggcgaggcctatgcctttcactatggc
tggtccggcgggcatcggatgatcgccgaagaactgcccgatgggcgccgtcaaattcaa
ttcgggcacgccgcaggcacgcacatgacgccagccaccgagtttcagaccgcgcctatc
tatgcggtctattcctgcgagggcctgaacggctgcgccgtcccgtttcaacgccatgtg
cgcgaccggatcgtcgcgtggaccgacacgggccgtccgcgcccggtgcattacaactgc
tgggaagcggtctatttcaaccacgacctcgccgtgctcaaggatatcgccagccgcgcc
gccgcccttggtgcggagcgtttcgtgctggatgacggatggttcgggcagcgcgacgat
gacacctcttcgctgggcgattgggcggtggatacacgcaaataccccgaaggcctcgac
ccgctgatcgcgcatgtgcgggcacagggcatgggtttcggcatctggtttgaaccggaa
atgatcaacccggactcagacacctaccgcgcacatcccgactgggcgctggggcctgcg
gaccagatccttggacgccagcaaaaactgctgaacatggccctgccacaggtgcgcgat
tatctctatgaccgcatcgccgcgctgctgaccgcccatccgatcgactacatcaaatgg
gaccacaaccgcgtcctgcccatgcccgatgcggcgcagaccgacgggagctatgcgttg
atcgaccggctgcgcgccgatttcccgcaggtggaaatcgaaagctgcgcctcgggcggt
gggcggattgatttcggcatcctgcagcgcagccaaagggtctggttgtctgacagcaac
gacgcgttggaacgcctcagaattcagcacaacgccgcgctgttcctgcccgcctgcgtc
acgggcagccatgtgggcccgcgcagatgccatacctcgggccgtgtcctcgacattgca
ttgcgcgcatgggtcgccgcacagcgccacatgggtttcgagatggacccgcgcgaattg
accgagcgcgaggcggaagtgctgcgcgatgtcaccgggtggtggaaagacaaccgcgac
tggatggaacacgcggacatcctgcggctggacagttcggaccctgcggtcatcgcagaa
caacaactggcgcgcgacgggcgccagttcgtagcctttgtgggcaaatccggcacctcg
gatcagatcgccccacgtcccttgcgccttacgcggctggaccccgatgcgcgctacgcg
gtcagcctgcgcaaccgcgccgatgccccgcatctgtcgcgcgggtctttggcgctcaag
gacggccctgtgacactatccggtgcggcgctgatgcagcatggcgtgacactgccatgg
agctttcccgatttcatctgggtgctggagggccgccgcctgtga

DBGET integrated database retrieval system