KEGG   Roseobacter denitrificans: RD1_2865Help
Entry
RD1_2865          CDS       T00376                                 

Gene name
rafA
Definition
alpha-galactosidase (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
rde  Roseobacter denitrificans
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:rde00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:rde00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:rde00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RoseoBase: 
UniProt: 
Position
2734352..2736436
Genome map
AA seq 694 aa AA seqDB search
MTECWRLDDARQTLALASTNGRCPQVIYWGAPLPPGEDLCALSDVSTLDVTGGMLDQNPD
LSLCPEAARSFPGQPGLIVRDRDGTPFLPKFRLDHVTQSELTLTVTCVDAPHGLTYVAEF
TLDADTHVIAMTARLSADRPLHLDWLAAPVLPAPQHSEAMIDFAGRWCGEFQMNRTPWSP
GIRMRENRTGRTGHEHFPGLIVPCKGARNTAGEAYAFHYGWSGGHRMIAEELPDGRRQIQ
FGHAAGTHMTPATEFQTAPIYAVYSCEGLNGCAVPFQRHVRDRIVAWTDTGRPRPVHYNC
WEAVYFNHDLAVLKDIASRAAALGAERFVLDDGWFGQRDDDTSSLGDWAVDTRKYPEGLD
PLIAHVRAQGMGFGIWFEPEMINPDSDTYRAHPDWALGPADQILGRQQKLLNMALPQVRD
YLYDRIAALLTAHPIDYIKWDHNRVLPMPDAAQTDGSYALIDRLRADFPQVEIESCASGG
GRIDFGILQRSQRVWLSDSNDALERLRIQHNAALFLPACVTGSHVGPRRCHTSGRVLDIA
LRAWVAAQRHMGFEMDPRELTEREAEVLRDVTGWWKDNRDWMEHADILRLDSSDPAVIAE
QQLARDGRQFVAFVGKSGTSDQIAPRPLRLTRLDPDARYAVSLRNRADAPHLSRGSLALK
DGPVTLSGAALMQHGVTLPWSFPDFIWVLEGRRL
NT seq 2085 nt NT seq  +upstreamnt  +downstreamnt
gtgacagagtgctggcggctggatgacgcgcgccagacgctggcgcttgcctcgacaaat
gggcggtgcccgcaggtcatttactggggcgcgcccctgccaccgggcgaagacctgtgc
gcgctcagcgatgtcagcacgctcgatgtgacgggtggcatgctggatcagaacccggat
ctgtcgctctgccctgaggctgcacgcagcttcccgggccagcccggtctcattgtgcgt
gaccgggacggcacgcctttcctgccgaaattccggctggatcacgtgacacagtccgag
ctgaccttgaccgttacctgcgtcgatgcgccccacgggctgacctatgtggccgaattc
acgctggatgccgacacccatgtgattgccatgacagcacggttatctgctgaccgcccg
ctgcatctggactggctggcggcccccgtcctgcccgccccgcagcacagcgaggcgatg
attgatttcgcaggccgctggtgtggtgagtttcagatgaaccgcacgccatggtcgccg
ggcatccgcatgcgcgaaaaccgcacggggcgcacgggccacgaacatttccccggtctg
atcgtgccctgcaagggggcgcgcaataccgcaggcgaggcctatgcctttcactatggc
tggtccggcgggcatcggatgatcgccgaagaactgcccgatgggcgccgtcaaattcaa
ttcgggcacgccgcaggcacgcacatgacgccagccaccgagtttcagaccgcgcctatc
tatgcggtctattcctgcgagggcctgaacggctgcgccgtcccgtttcaacgccatgtg
cgcgaccggatcgtcgcgtggaccgacacgggccgtccgcgcccggtgcattacaactgc
tgggaagcggtctatttcaaccacgacctcgccgtgctcaaggatatcgccagccgcgcc
gccgcccttggtgcggagcgtttcgtgctggatgacggatggttcgggcagcgcgacgat
gacacctcttcgctgggcgattgggcggtggatacacgcaaataccccgaaggcctcgac
ccgctgatcgcgcatgtgcgggcacagggcatgggtttcggcatctggtttgaaccggaa
atgatcaacccggactcagacacctaccgcgcacatcccgactgggcgctggggcctgcg
gaccagatccttggacgccagcaaaaactgctgaacatggccctgccacaggtgcgcgat
tatctctatgaccgcatcgccgcgctgctgaccgcccatccgatcgactacatcaaatgg
gaccacaaccgcgtcctgcccatgcccgatgcggcgcagaccgacgggagctatgcgttg
atcgaccggctgcgcgccgatttcccgcaggtggaaatcgaaagctgcgcctcgggcggt
gggcggattgatttcggcatcctgcagcgcagccaaagggtctggttgtctgacagcaac
gacgcgttggaacgcctcagaattcagcacaacgccgcgctgttcctgcccgcctgcgtc
acgggcagccatgtgggcccgcgcagatgccatacctcgggccgtgtcctcgacattgca
ttgcgcgcatgggtcgccgcacagcgccacatgggtttcgagatggacccgcgcgaattg
accgagcgcgaggcggaagtgctgcgcgatgtcaccgggtggtggaaagacaaccgcgac
tggatggaacacgcggacatcctgcggctggacagttcggaccctgcggtcatcgcagaa
caacaactggcgcgcgacgggcgccagttcgtagcctttgtgggcaaatccggcacctcg
gatcagatcgccccacgtcccttgcgccttacgcggctggaccccgatgcgcgctacgcg
gtcagcctgcgcaaccgcgccgatgccccgcatctgtcgcgcgggtctttggcgctcaag
gacggccctgtgacactatccggtgcggcgctgatgcagcatggcgtgacactgccatgg
agctttcccgatttcatctgggtgctggagggccgccgcctgtga

DBGET integrated database retrieval system