KEGG   Roseobacter denitrificans: RD1_2869Help
Entry
RD1_2869          CDS       T00376                                 

Gene name
bgaT
Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
rde  Roseobacter denitrificans
Pathway
Galactose metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:rde00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RoseoBase: 
UniProt: 
Position
2738962..2740872
Genome map
AA seq 636 aa AA seqDB search
MSSGLQRALGVCYYPEHWPEEIWARDAARMVSAGITWVRIGEFAWSRMEPEPGRFTFDWL
DRAIDVLASAGLRIVLGTPTCTPPRWMLDRFPDMLAVDAMGRVRKFGSRRHYCFSHAGYR
AASAAIADVLGQRYGQDPRIHAWQLDNEYGCHDTVLSYSEAARHAFQDWLATRYDTIDAL
NTAWGNVFWSMEYDSFAQVDLPNLTVTEPNPSHALAFRRFSSDQVVAYHTAQVEALRAHT
DAPLIHNYMGRVLDFDHFEVGRSIEIASWDSYPIGFLSDRLEATPAHKSHYLQQGDPDMQ
AFHHDLYRAVGRDGRWWVMEQQPGPVNWAPYNPAPLPGMVRLWTWEAFAHGAEVVSYFRW
RQAPFAQEQMHSGLLRPDDAPAPGLAEAEKVAAELRSMPEVCVQQAQVALVFDYASEWAW
ATLPQGAGFRYFALMLDAYRALRKRGLSIDILPSTTSDVTGYKLVLAPGVATLPESLKRA
LGQTTAIVGPRCNAVTEELTIPTPMGPDLPDLDVTVTRVESLPPGVERSVPGIGAVQHWT
ETLEGSAQVTLRDADGAAVMVSNGALSYLGGWPDSALWDHLIADAAARCGIDTQPLPDGL
RCRDTKTHRFYFNYAATPCAFDGLSLPAAGVAWARR
NT seq 1911 nt NT seq  +upstreamnt  +downstreamnt
atgagttccggcctccaacgcgcgctcggcgtctgctactatcccgaacactggcccgaa
gagatctgggccagggacgccgcgcgcatggtttcagcaggcatcacatgggtgcgcatc
ggcgaattcgcatggagccggatggaaccggaaccggggcgtttcacctttgactggctg
gaccgggcgattgacgttctggccagcgcgggcctcaggatcgttctgggcacgcccacc
tgcacccccccgcgctggatgctggatcggtttcccgacatgctggcggtggatgccatg
gggcgcgtgcgcaaattcggctcccggcggcactattgctttagccatgcaggctatcgc
gctgcctcggcggcgattgccgatgtgctggggcaacggtacggacaggacccgcgcatc
cacgcatggcaattggataacgaatacggctgccatgacaccgtgctgtcctattccgag
gccgcgcgccacgcgtttcaggactggctcgcgacacgctacgacaccatcgacgcgctg
aacaccgcctggggcaatgtgttctggtcgatggaatacgacagttttgcgcaggtggat
ttgccaaacctgacggtcacagagcccaaccccagccatgcgctggcctttcgacgattc
agttccgatcaggtcgtcgcctatcacacggcacaggtagaggccctgcgcgcccacacg
gatgcgccgctgatccacaactacatgggccgggtgctggattttgaccatttcgaggtc
ggccgctccatcgagatcgcaagctgggacagctacccgatcgggttcctctctgaccgg
ctggaggcaacgcccgcgcataaatcgcactatttgcagcagggcgatcccgatatgcag
gcctttcaccacgacctttaccgggcggtgggcagggatggccgctggtgggtgatggaa
caacaacccgggccggtcaactgggcgccctataatccggccccattgcccggcatggtg
cggctctggacgtgggaggcctttgcccatggggcagaggtcgtgagctattttcgatgg
cggcaggccccttttgcgcaggaacagatgcattcgggcctgctgcgccctgatgatgct
ccggcccccgggctggccgaggccgaaaaggttgctgcagaactgcgcagcatgcctgag
gtgtgcgtgcagcaggcgcaggtggcattggtctttgactacgcctcggaatgggcctgg
gcgacgttgccgcagggggcggggttccgctattttgccctgatgctggatgcctaccgg
gccttgcgcaaacgcgggctgtcgattgatatcctgccctcgaccacatccgatgtgacg
gggtacaagctggtgctcgcgcccggtgtggccaccctgcccgaaagcctgaaacgcgcg
cttggccagacaacggccatcgtggggccgcgttgcaacgccgtaacagaggaattgacg
ataccgacgcccatgggcccggatttgccggacctcgatgtgacggtcacgcgggtggag
agcctgccgcccggcgtcgagcggagcgtgcccggcattggcgcggtgcaacactggact
gaaacgcttgaagggtccgcgcaggtaactctgcgggatgcggatggcgcagcggtgatg
gtgtcaaacggtgcgctgtcttatctgggcggctggccggattcagcgctttgggatcat
ctgatcgccgatgcggcggcgcgttgcggcatcgacacgcagcccctgcccgacggtctg
cgctgccgggataccaaaacgcaccggttctatttcaactacgccgccacgccctgtgcg
tttgacgggctgagcctgcccgctgctggcgtggcttgggcccggcgctga

DBGET integrated database retrieval system