KEGG   Roseobacter denitrificans: RD1_2871Help
Entry
RD1_2871          CDS       T00376                                 

Gene name
malQ
Definition
(GenBank) 4-alpha-glucanotransferase
  KO
K00705  4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
rde  Roseobacter denitrificans
Pathway
rde00500  Starch and sucrose metabolism
rde01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rde00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    RD1_2871 (malQ)
Enzymes [BR:rde01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     RD1_2871 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_77 DUF4224
Motif
Other DBs
NCBI-ProteinID: ABG32397
RoseoBase: RD1_2871
UniProt: Q165E6
Position
complement(2742505..2744502)
Genome map
AA seq 665 aa AA seqDB search
MRGDAALSRLAQEVGVVAEYQDMQGITHVTPPETQWAMLRANGYPAQTHAEIRETLAALH
AARQTAYLQQEIVLRCDQPCDITCAAPVTWHVLCEGSQEVLAEGRAQSRIALPGLRMGVH
TLVLEGAKGVQETWLITAPAGAPSLEQIAGTPRCWGVMAALYGLGPAASQIGSFDDLAQA
AAVCGQAGAAFLGINPVHALGMAAGDTISPYSPTHRGFLNTDHITMSSRTPTPGDAGDLL
DYAQHRHAQRPALRREFEAFLGMSPAPERSAFDAFCDVEGARLIEFAIFEQVSQQHGPDW
RVWPHRLHDPKNALHEISNRDLMFHKWLQWRADTQLASAQKAARDAGMALGLYLDLAVGA
RVGGAETWGTDTATADGVSLGAPPDHLSPAGQNWQLAALSPVRLKATRYAALRAILAKNM
RHAGLMRIDHALGLSRSFWIPQDGSPGAYMRQPLKSLVALIAIEAHRAGTVIVGEDLGLV
PDGFRAEMARHGFYGYCVLQYEKDAEGVLLPPEHLRAQSLACFGTHDTPTLAGFWQGRDI
DWWHRLGWIDASDAARARRARVQEKRQLVATPAPKRLPRKVTAAVRDKVYADLAASPAAL
VAVQLDDMLSLTEAQNLPGTVDAHPNWRRRYPVRGQALAKDKALQATSLIMARAARNTAE
RKDER
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
atgcgtggtgatgccgccttgtcccgccttgcgcaagaggtcggcgttgtggccgaatat
caggacatgcagggcatcacgcatgtaacgccccccgagacgcagtgggcgatgttgcgc
gccaatggctatcctgcccaaacccatgccgaaatccgcgaaacactggcggcgttgcac
gcggcgaggcaaaccgcctatctgcagcaggagattgttctgcggtgtgatcagccgtgt
gacattacctgcgcggcaccggtcacatggcatgtgctgtgcgaagggtcgcaagaggtt
ctcgcagaggggcgcgcacaatcccggattgcactgcccggcttgcggatgggggtgcat
acccttgtgctggagggcgcaaagggggttcaggaaacctggctgatcacggcacctgcg
ggcgcgccatcgctggaacagattgccggaacaccgcggtgctggggtgtgatggccgcc
ctttacgggctgggtcccgctgcatcgcagatcggcagctttgatgatctggcgcaggcc
gcggcggtttgcggtcaagcaggcgcggcgtttctggggatcaacccggtgcatgcattg
ggcatggcggcgggggacacgatcagcccttattcccccacacatcgcgggtttctcaat
accgatcatatcacgatgagcagtcgcacgcccacgccaggcgacgcgggcgatctgctg
gactatgcgcagcaccgccacgcgcaacggcccgccctgaggcgtgaattcgaggcattt
ctgggcatgtcgcccgcccctgagcgcagcgctttcgatgcgttttgtgatgtcgaaggg
gcgcgtctgattgaattcgccattttcgaacaggtcagccagcaacacggacccgattgg
cgggtctggccgcacaggctgcacgatccgaaaaacgcgctgcatgagatatccaacagg
gatctgatgtttcacaaatggctgcagtggcgcgcggatacacagcttgccagcgcacag
aaagccgcgcgtgacgcagggatggcgctggggctctatcttgatctggccgtgggcgcg
cgtgttggcggggccgagacatggggcacagacacggccacagccgatggcgtctcgctt
ggcgcaccgccggatcacctcagcccggcagggcagaactggcagcttgcagcgctctcc
ccggtcaggctcaaggcgacgcgctacgccgccctgcgcgccattctggcgaagaacatg
cgacatgcagggctgatgcggatcgaccatgccctggggctgagccgcagcttctggatc
ccgcaggatggcagcccgggggcctatatgcgccagccactgaaatcactggtggcgctg
attgccattgaggcgcatcgcgcaggcacggtgatcgtgggcgaagaccttggccttgtc
ccggacgggtttcgtgccgagatggcgcgccacgggttttacggctattgcgtgctgcaa
tatgaaaaagacgccgagggggtgcttctgccaccggagcatttgcgcgcgcagtctctg
gcctgctttggcacgcatgacacgccgacgctggcggggttctggcaggggcgtgacatt
gactggtggcatcgcttgggttggatcgacgcaagcgacgccgcacgggcgcgacgcgca
agggtgcaggaaaaacgccagctggttgcgaccccggcgcccaaacgcttgcccagaaag
gtcacagcagccgtcagggacaaggtgtacgcggatctggcggcatccccggctgccttg
gtggcggtgcagcttgacgatatgttgtctttgacagaggctcagaacctgccggggacc
gttgacgcgcatccaaactggcgtcggcgctacccggtgcgcgggcaggctctggccaag
gacaaggcactgcaggccacaagcctgatcatggcgcgcgccgcgcgaaataccgcagaa
cgaaaggacgagcgatga

DBGET integrated database retrieval system