KEGG   Roseobacter denitrificans: RD1_2875Help
Entry
RD1_2875          CDS       T00376                                 

Gene name
glgB
Definition
(GenBank) 1,4-alpha-glucan branching enzyme
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
rde  Roseobacter denitrificans
Pathway
rde00500  Starch and sucrose metabolism
rde01100  Metabolic pathways
rde01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rde00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    RD1_2875 (glgB)
Enzymes [BR:rde01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     RD1_2875 (glgB)
Exosome [BR:rde04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RD1_2875 (glgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CBM_48 Alpha-amylase_C Alpha-amylase AMPK1_CBM
Motif
Other DBs
NCBI-ProteinID: ABG32401
RoseoBase: RD1_2875
UniProt: Q165E2
Position
complement(2749344..2751539)
Genome map
AA seq 731 aa AA seqDB search
MNISQTDAEKLAAGCHGNPFSVLGLHEVAGKLSLRVFLPGAETVEALDPKTGRVIVTLNQ
TETPGLFEGTAARRKKRFAYHLRITQGAHQWQMDDPYRFGPVIGDIDEYLLGEGSHRRLW
SVLGAHVITHEGVAGTHFAVWAPNAQRVSVVGEFNVWDGRRMMMRQRGATGVWEIFVPGI
GEGEIYKYEIIAPDGSLLPQKADPVGFGAEHPPRTGSVVRKIDGYAWDDAQWMTRRADVQ
RIDQPVSIYEVHLGSWRRVPEDGNRPLSYVELADQLVAYVKDMGFTHMEVMPVSEFPFDG
SWGYQPIGLFAPTIRHGTLDEFRALVAACHRENIGVILDWVPGHFPEDAHGLGRFDGTAL
YEHADRKEGFHPDWNTLVYNYGRAEVANYLAANALYWLQEHHVDGLRVDAVASMLYRDYS
RKDGEWIPNRDGGRENYEAISFLQKVNTESYGEVPGIMTIAEESTAFPGVSAPVDAGGLG
FGFKWNMGWMNDTLQYMQQDPIHRKYHHHEMTFGLHYAFSENFILPLSHDEVVHGKGSLL
DKMPGQGDDKFANLRAYYGFMWGHPGKKLLFMGCEFAQGVEWNHDSSLDWHLLDHPQHRG
MQNLVRDLNALYRENAALHGLDCAAQGFEWIDENNAEASVLAWLRHGPDGGAPMLVVSNF
TPVERSHYRLGVPQAGRWVERLNTNADCYGGTGLGNLGGVQSADIAAAGRPFSIDVVLPP
LTTLFFQLDDG
NT seq 2196 nt NT seq  +upstreamnt  +downstreamnt
gtgaatatctcacaaacagatgccgaaaagctcgccgcggggtgtcacggcaatccgttt
tccgtgctcggcctgcatgaggttgcgggaaagctgagcctgcgcgtctttctgcccggt
gccgagactgtggaggcgctggaccccaagaccgggcgcgtgatcgtcacgctcaaccag
acggaaacgccggggcttttcgagggcaccgcggcgcggcgcaagaagcgttttgcctat
catctgcgcatcacccaaggcgcgcatcagtggcagatggatgatccttatcgctttggc
cccgtgatcggggatatcgacgaatatcttctgggagagggctcacatcgtcgcctatgg
agtgtgttgggcgcccatgtcattacgcatgaaggtgttgcaggcacgcatttcgccgtc
tgggcccccaatgcgcagcgcgtgtcggtggttggcgaattcaacgtctgggatggtcgg
cgcatgatgatgcgccagcggggggcgaccggtgtttgggaaatcttcgtgcccggcatt
ggcgagggcgagatttacaaatacgaaatcatcgcgccggatggatcactgctgccgcaa
aaggcggacccggtcggtttcggggccgagcacccgccgcgcaccggatcggttgtgcgc
aagatcgacggctacgcgtgggatgatgcgcagtggatgacgcggcgcgcggatgtgcag
cgcattgatcagcccgtgtcgatctatgaggtgcatctcggctcatggcggcgcgtgccg
gaagatggcaatcgcccgctcagctatgtggaactggccgatcaactggtggcttacgtc
aaggacatggggttcacccatatggaagtgatgccggtctctgaatttccttttgacggg
tcatggggctatcagcccatcgggctctttgcaccgacgatccgccatggcacgttggac
gaattccgcgcgctggtcgctgcgtgccaccgggaaaacatcggcgtgatcctcgactgg
gtgccggggcattttccggaggatgcgcatgggctgggccggtttgacggcacggccctt
tacgaacatgccgaccgcaaggaagggtttcaccccgattggaacacgctggtctacaac
tacgggcgggcggaggtcgcaaattaccttgcggcgaatgcgctttactggctgcaggaa
caccatgtcgatgggctgcgtgtggatgcggtcgcctcgatgctctaccgcgactattcg
cgcaaggatggcgagtggatcccgaacagggacggcgggcgcgagaactacgaagccatt
tcattcttgcagaaagtgaacaccgaaagttacggcgaggtgccgggcatcatgaccatt
gccgaggaatccaccgcctttccgggtgtgagcgcgccagtggacgcaggggggctgggc
tttggcttcaagtggaacatgggttggatgaacgatacgctgcaatacatgcagcaggat
ccgatccatcgcaaataccaccaccacgagatgacctttggcctgcactatgccttttcg
gaaaacttcatcctgccgctcagccatgatgaggtggtgcatggcaaggggtcattgctc
gataagatgccggggcagggggatgacaaattcgcaaacctacgcgcctattacggcttc
atgtgggggcatccgggcaaaaagctgctgttcatgggctgcgagtttgcacagggcgtt
gagtggaaccacgacagcagtcttgactggcacctgttggatcacccgcaacaccgcggc
atgcagaaccttgtgcgtgatctgaacgcgctctaccgggaaaatgcggcgcttcatggt
ctggactgcgcagcgcaaggttttgaatggattgacgaaaacaacgccgaggcgtcggtc
cttgcctggctgcgacatgggccggatggcggcgcaccgatgcttgtggtgagtaatttc
acgccggtcgagcgatcacattatcgcctcggcgtgccgcaggccgggcgatgggtggag
cggctgaataccaatgcggattgctatggcgggaccggtttgggcaacttgggcggtgtg
caaagcgccgatatcgcggccgccggtcggcccttttcgatcgacgtggttttgccgccg
ctcaccacgctgttttttcagctggatgacgggtga

DBGET integrated database retrieval system