KEGG   Roseobacter denitrificans: RD1_2962Help
Entry
RD1_2962          CDS       T00376                                 

Gene name
cyp
Definition
cytochrome P450
Orthology
K00493  
unspecific monooxygenase [EC:1.14.14.1]
Organism
rde  Roseobacter denitrificans
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rde00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    RD1_2962 (cyp)
  Amino acid metabolism
   00380 Tryptophan metabolism
    RD1_2962 (cyp)
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    RD1_2962 (cyp)
Enzymes [BR:rde01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     RD1_2962 (cyp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RoseoBase: 
UniProt: 
Position
2839430..2840647
Genome map
AA seq 405 aa AA seqDB search
MPLLSQADLKAAMQRLIQSPLDPAFVQNPYAFYAEVFTGDTIRYWQDYDMPAIFDAANVQ
AVLRNRRFGRALPADRIGPPRPHLAAFDAVEAVSMLDLEPPDHTRLRGLVLRAFTSRRIK
ALAPDIHDICDRLIADLPKGGCNLIPAFCTALPVRIIARLLGVPAERCGDLLRWSNAMVA
MYQAGRTLEIEHAANAAASEFTAFLSDYIDIKRRAPQDDLISHLLLAEENGQKLTRQELI
GTCILLLNAGHEATVHTMGNAVKALLEHQTPPQAFTDQNIAATVEEVLRFDPPLHMFTRY
SYEDTEIGDHTIRSGQQVALMLGAAGRDPALCKDPDVFDPFRAPVPHAAFGGGLHFCVGA
PLARLELQIGLQRLFAARPNLTLSSPPRFANAYHFHGLERLDVTT
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgcctctactttctcaagcggacttaaaggcggccatgcaacgacttatccaatccccg
ctggacccggctttcgtgcaaaacccctatgcattttacgctgaggtttttaccggcgac
accattcgctactggcaagactacgacatgcccgcaatttttgatgccgccaacgtacag
gcggtcctgcgcaatcgtcgcttcgggcgcgcactgccggcggatcggatcggtccaccg
cgcccccacctcgccgcctttgatgccgtcgaagcagtctccatgcttgatctggagccg
cctgatcacacccggttgcgcggcctggtgctgcgcgcctttacctcgcgccgaatcaag
gcgctggcgcctgacattcacgacatctgcgaccggctgatcgcggacctgccaaagggc
gggtgcaacctgatccccgcattttgcacggcactcccggtgcgcatcattgcccggctg
ctgggtgtgcctgcggaacgctgcggtgatctgttgcgctggtccaatgcaatggtggcg
atgtatcaggccgggcgtacgctcgagatcgaacacgccgccaacgcggccgcaagcgag
ttcactgccttcctgtctgattacatcgacatcaaacggcgcgccccgcaggacgacctg
atcagccacctgctgctggccgaggaaaacggccaaaaactcacccggcaagagttgatc
ggcacctgtatcctgctgctcaatgccgggcacgaggcgacggtgcacacaatgggcaac
gcggtcaaagcgctgctggaacatcaaacgccgccacaggccttcaccgatcagaatatc
gccgcaacagtcgaagaggtgctcaggttcgacccgccgttgcacatgttcacccgctac
agttacgaggacaccgaaatcggcgaccacacgatccgcagcggtcagcaggtcgccttg
atgctcggtgccgctggccgtgatccggccctatgcaaggatccggacgtttttgatccg
tttcgcgcacccgtcccacatgccgcttttggcggtgggttgcatttttgcgtcggcgcg
ccactcgcccggcttgagttgcaaatcggcttgcaaaggctctttgccgcccgcccgaac
ctcaccctcagcagcccgcctcgatttgccaatgcgtaccactttcacggcctcgaacgc
ctcgacgtcaccacctga

DBGET integrated database retrieval system