KEGG   Roseobacter denitrificans: RD1_2962Help
Entry
RD1_2962          CDS       T00376                                 

Gene name
cyp
Definition
cytochrome P450
Orthology
K00493  
unspecific monooxygenase [EC:1.14.14.1]
Organism
rde  Roseobacter denitrificans
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Class
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:rde00071]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:rde00380]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:rde00627]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RoseoBase: 
UniProt: 
Position
2839430..2840647
Genome map
AA seq 405 aa AA seqDB search
MPLLSQADLKAAMQRLIQSPLDPAFVQNPYAFYAEVFTGDTIRYWQDYDMPAIFDAANVQ
AVLRNRRFGRALPADRIGPPRPHLAAFDAVEAVSMLDLEPPDHTRLRGLVLRAFTSRRIK
ALAPDIHDICDRLIADLPKGGCNLIPAFCTALPVRIIARLLGVPAERCGDLLRWSNAMVA
MYQAGRTLEIEHAANAAASEFTAFLSDYIDIKRRAPQDDLISHLLLAEENGQKLTRQELI
GTCILLLNAGHEATVHTMGNAVKALLEHQTPPQAFTDQNIAATVEEVLRFDPPLHMFTRY
SYEDTEIGDHTIRSGQQVALMLGAAGRDPALCKDPDVFDPFRAPVPHAAFGGGLHFCVGA
PLARLELQIGLQRLFAARPNLTLSSPPRFANAYHFHGLERLDVTT
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgcctctactttctcaagcggacttaaaggcggccatgcaacgacttatccaatccccg
ctggacccggctttcgtgcaaaacccctatgcattttacgctgaggtttttaccggcgac
accattcgctactggcaagactacgacatgcccgcaatttttgatgccgccaacgtacag
gcggtcctgcgcaatcgtcgcttcgggcgcgcactgccggcggatcggatcggtccaccg
cgcccccacctcgccgcctttgatgccgtcgaagcagtctccatgcttgatctggagccg
cctgatcacacccggttgcgcggcctggtgctgcgcgcctttacctcgcgccgaatcaag
gcgctggcgcctgacattcacgacatctgcgaccggctgatcgcggacctgccaaagggc
gggtgcaacctgatccccgcattttgcacggcactcccggtgcgcatcattgcccggctg
ctgggtgtgcctgcggaacgctgcggtgatctgttgcgctggtccaatgcaatggtggcg
atgtatcaggccgggcgtacgctcgagatcgaacacgccgccaacgcggccgcaagcgag
ttcactgccttcctgtctgattacatcgacatcaaacggcgcgccccgcaggacgacctg
atcagccacctgctgctggccgaggaaaacggccaaaaactcacccggcaagagttgatc
ggcacctgtatcctgctgctcaatgccgggcacgaggcgacggtgcacacaatgggcaac
gcggtcaaagcgctgctggaacatcaaacgccgccacaggccttcaccgatcagaatatc
gccgcaacagtcgaagaggtgctcaggttcgacccgccgttgcacatgttcacccgctac
agttacgaggacaccgaaatcggcgaccacacgatccgcagcggtcagcaggtcgccttg
atgctcggtgccgctggccgtgatccggccctatgcaaggatccggacgtttttgatccg
tttcgcgcacccgtcccacatgccgcttttggcggtgggttgcatttttgcgtcggcgcg
ccactcgcccggcttgagttgcaaatcggcttgcaaaggctctttgccgcccgcccgaac
ctcaccctcagcagcccgcctcgatttgccaatgcgtaccactttcacggcctcgaacgc
ctcgacgtcaccacctga

DBGET integrated database retrieval system