KEGG   Roseobacter denitrificans: RD1_3107Help
Entry
RD1_3107          CDS       T00376                                 

Definition
regulatory protein
Orthology
K13924  
two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
rde  Roseobacter denitrificans
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:rde00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    RD1_3107
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    RD1_3107
Enzymes [BR:rde01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.80  protein-glutamate O-methyltransferase
     RD1_3107
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     RD1_3107
Two-component system [BR:rde02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   RD1_3107
Bacterial motility proteins [BR:rde02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    RD1_3107
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RoseoBase: 
UniProt: 
Position
complement(2983032..2986286)
Genome map
AA seq 1084 aa AA seqDB search
MKDENKDITIIGIGSSAGGLEAIRELVATLPTNMNVAYVVVQHMSPHHKSLMTELVARQT
SLSVKDVKDGILPEPNVIYVTPPNTDIIYDDGKLRLIEPSHEVASPKPSVDRFLLSLADQ
HGESAMAIILSGTGTDGAYGVQAIREAGGITIAQDTESAKYDGMPMSAMQTGCVDLVLRP
FEIGTHLQKILSSARDFDAFRQETSDTSPALDLLQILLARTRVDFREYKQTTINRRIERR
MVALGIETHAEYTQFCRENPNAVDALFKDLLISVTRFFRDKSEFEQLKEMLPALLKKKET
RPFRVWIAGCATGEEAYSIAMLLSEALGGPTVNLKDHVQIFATDIDKEALDVARKGVYGM
AALNDIPKTLSDRYFMTQNDGIRVIDSLRSAILFSDHNVCQDPPFQKVDLLCCRNLLIYF
GNALQHKVMSRFHYAMTDNSLMFLGTAETVAGSDEMFVQDSHSAHIYRRRSIRRSDQNVF
SNPRNLPQSRSKVPAPAKQGQEQGQSTDRQMFEALALALGKNSVLVTDDYGIIRVYGNVS
PFIEMNETSNLKMHIDLLRRPFREEARSLVTLALKHGEHRSGVRHLLAEDDDAEIRLDVY
PIVARDINERAALVVFSEMKVDRSKAAGTSEVDEDTVFESDRIRLLEDEVATTREALQQT
IEELETSNEELQSLNEELQSTNEELQATNEELETSNEELQSTNEELITVNEELQVTAAEL
SGRTGELMSVLETAPLSIMVLDTALQISQATNAACDMFSLARPVSNPHVSQCVLPNNFPP
LAPICNETLKLGEPISKEFNSGGSRYKLTSSPFFDMRGQMKGVTIVISAFPGLAQELELI
LDHGELYMLNRAQDGTILRISEKSARFFGTTRNKAEGANFYNLVSRSISNTIREHDARLM
KAEGGHLRDMLRLRSVEDNTEICLNSENFLFDNLAGGEASIYTIGQDISEVIETRDKAEE
SLAQLILLQEIARIGFWSLDLENDKVFWSEEVYRIHGKDPDTFSPKLEDGLSFYHPDDRK
TVQAEVEKVRTLGGEFHFKMRIINADGETVPVESFGLARQDMHGNIGKIIGVFRVCEDEG
PTTH
NT seq 3255 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagacgagaacaaagatatcaccatcatcggcatcgggtcttcggctggtggtctt
gaggcaatccgcgaactcgtcgcgaccttgccgacgaatatgaacgtggcatatgtggtc
gttcaacacatgtcgcctcatcacaaaagcctgatgaccgaactggttgcgcgccaaacc
agcctgagtgtaaaggatgtcaaggacggcattctgccagagccgaatgtcatatacgtt
acccccccgaacaccgatatcatctatgatgatggcaagctgcgtctgatcgagcccagt
catgaggtggcatcgcccaaaccctccgtcgaccggttcttgttgagtctcgctgatcag
catggtgagagcgccatggcaatcatcttgtccggcacagggacagacggtgcctatggt
gtgcaggcgatccgcgaggcaggcgggatcaccattgcgcaggatacggaaagcgccaaa
tacgacggcatgccgatgtcagcgatgcaaacgggttgcgttgatctggtcttgcggccc
ttcgaaatcgggacgcacttacagaagatactctcctctgcccgtgactttgatgccttt
cgtcaggaaacgtccgacaccagcccggcattggatctgttgcaaatccttcttgcccgc
acgcgcgtggactttcgcgagtacaagcaaaccacgatcaaccggcgcatcgagcgccgt
atggtggccctggggatcgaaacgcatgcggaatacacgcaattctgtcgtgagaatccg
aatgccgtggatgcgctcttcaaggatctgttgatatcggtcacccggtttttccgcgac
aagtccgagtttgagcaactcaaggagatgttgcccgcactgctcaagaaaaaggaaacc
cgcccgtttcgggtctggatcgccggatgtgcaacgggggaagaggcctattcgatcgcg
atgctgctctcggaagcgcttggggggccaacggtaaacctcaaggaccacgtgcagata
tttgcaactgacatcgataaagaggctttggacgtcgcacgcaagggcgtctacgggatg
gccgcgctgaacgacatccccaaaaccctgtcggatcgctatttcatgacgcagaacgat
ggcatccgggtgatcgattccctgcgttcggccatcctgttttccgatcacaacgtctgt
caggatccgccctttcagaaggtggatttgctctgctgccgtaaccttttaatttatttt
ggaaatgccctgcagcacaaggtcatgtcgcggttccactacgccatgactgacaactcc
ctgatgttcttggggacggcggaaacagtcgcggggtccgacgagatgttcgttcaggac
agtcattctgcccatatataccggcgccgctcgatccggcggtccgatcagaacgtgttt
tccaatccgcgaaacctgccacaatcgcgcagtaaggtgcccgcaccggccaaacagggt
caggagcagggccaatccacggaccgccaaatgttcgaggcgctggcgctcgctctgggc
aagaattcggttttggtaacggatgattacgggatcatccgggtctacgggaacgtcagc
cccttcatcgagatgaacgagaccagcaacctcaagatgcatatcgacctgttgcgccgg
ccatttcgtgaagaagcacgcagccttgtgacactggccctcaaacacggcgagcatcgc
agtggcgtgcgccatctgttggcggaagacgacgatgccgaaatccggctggatgtttat
ccgatcgtggcgcgcgacatcaacgaacgtgcggcgctggtggtgttctccgagatgaag
gtcgaccgctcgaaggcggccggtacgtcggaggtcgacgaggatacggtctttgaaagc
gacaggatccgtttgctcgaagatgaagtggcaacaacccgcgaggccctgcagcagacc
attgaggagttggaaacctccaacgaggaactgcaatccctgaacgaggaattgcaatcc
accaatgaggaattgcaggccaccaacgaggaattggaaacctccaacgaagagctgcaa
tccaccaacgaggagttgattacggtcaacgaagagcttcaggtcacggcggcggaactg
agcgggcgcacgggcgaattgatgtcggtccttgaaaccgcgccgctgtcgatcatggtg
ctggatactgccttgcagatatcgcaagcgaccaacgcggcctgcgatatgttcagtctg
gcgcgtccggtgtccaatccgcatgtcagccaatgtgtgctgcccaacaacttcccgccg
ctggccccgatctgcaacgaaaccctcaaactgggcgaaccgatctcaaaggaatttaat
tccggcggctcgcgctacaagctgaccagttcgcctttctttgacatgcggggccagatg
aagggggtcacgatcgtgatctctgcatttccgggcctggcgcaggagttggagcttatt
ctggaccatggtgaactctatatgctgaaccgggcccaggatggcaccatcctgcggatc
agcgaaaagtcggcacgttttttcggcacgacacggaacaaggcagaaggcgccaatttc
tacaatctggtgtcaaggagcatttcgaacaccatacgcgaacatgatgcgcggctgatg
aaggccgagggtgggcatctgcgcgatatgctgcgtctcagatctgtcgaagacaacacg
gaaatctgtctgaattcagaaaacttcctctttgataacctggcagggggggaggcgtcg
atttataccatcgggcaggatatctctgaggtgatcgagacacgtgacaaggcagaagaa
tctctggctcagttgatcctgttgcaggaaatcgcacgtatcggcttctggtcgctggat
ctggagaatgataaagtcttctggtccgaagaggtgtatcgcatccacggcaaagatccc
gatacattttctccgaaactggaggatggattgtctttctatcaccctgatgaccgcaaa
acggtgcaagctgaagtggaaaaagtgcgcacactgggcggagagtttcatttcaaaatg
cgcatcatcaatgcagacggggaaacggttccggttgagtccttcggtctggcccgtcag
gacatgcacggcaacatcggcaagatcattggcgtctttcgtgtctgtgaggacgaaggg
cccacaactcactag

DBGET integrated database retrieval system