KEGG   Roseobacter denitrificans: RD1_3109Help
Entry
RD1_3109          CDS       T00376                                 

Gene name
galM
Definition
aldose 1-epimerase (EC:5.1.3.3)
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
rde  Roseobacter denitrificans
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rde00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RD1_3109 (galM)
   00052 Galactose metabolism
    RD1_3109 (galM)
Enzymes [BR:rde01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     RD1_3109 (galM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RoseoBase: 
UniProt: 
Position
2987282..2988250
Genome map
AA seq 322 aa AA seqDB search
MISLRSASLTAQILPFGATLAGLWLDGHPDSLVIGSSDAEAYTDHLRYFGAVIGPIANRI
SGAALQIGGAAFSMEANEGSACLHSGASGLHARMWTVLRCSAAAVSLRCELPDGANGLPG
NRRVEAHYELTDDGQLVLELTAQSDRATAINLAHHPYWNLGNADTIQNHHLMVYADTYLP
VDQQILPTGEIAPVAQTAYDFQTLRAIPIDRTLDANLCLAKIRRARPEPAARLRGPSGVT
LQIDTTEPGLQIYNGSSLHDVPISLHDQRVLRPFSGIALEPQGWPDAPHNRAFPSIVLRP
GQTYRQKTIYRIWHELSEPATF
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgatttcgctgcgctccgcatcgctgaccgctcagattctgccttttggcgcgaccttg
gcagggctttggcttgacgggcatcccgacagcctcgtgatcggctcatccgatgcagag
gcttacacggaccacctgcgctattttggtgccgtcatcggcccgattgcaaaccggatt
tccggtgcggcgctccagattgggggcgctgcgttcagtatggaagcgaatgaaggcagc
gcctgcctgcacagcggggccagcgggctgcacgcacgcatgtggacagtcttgcggtgt
tcagcggcggccgtctccttgcgatgcgagttgccagatggcgcaaatgggctgcccggc
aatcggagagttgaggcacattacgagctgacggatgatggccagttggtgctcgaactg
acggcgcaaagcgaccgcgcaacggccatcaatctcgcgcatcacccctattggaacctt
ggcaacgcagacaccatacagaaccaccatctgatggtttacgcggatacctacctgccg
gtcgaccaacaaatcctgccgacaggtgaaatcgcgcctgttgcgcaaacagcctatgat
tttcaaaccctgcgggcgatcccaatcgaccgaacactggatgcgaacttatgccttgcc
aaaatacggcgcgcgcgccccgaaccggctgcgcgcttgcgcggtccgtcaggtgtgacc
ctgcaaatcgacaccacggaaccgggactgcaaatctacaatggcagcagtttacacgat
gtgcctatttcacttcatgatcaacgtgttctgaggcccttttcaggtatcgcattagag
ccgcaaggctggcctgacgcgccacacaaccgcgcttttcccagcattgttttacgcccg
ggtcagacataccggcaaaaaacgatctatcggatttggcacgaattgagcgaacccgcc
acattctga

  All links  
No link information was found.   
DBGET integrated database retrieval system