KEGG   Roseobacter denitrificans: RD1_3109Help
Entry
RD1_3109          CDS       T00376                                 

Gene name
galM
Definition
(GenBank) aldose 1-epimerase, putative
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
rde  Roseobacter denitrificans
Pathway
rde00010  Glycolysis / Gluconeogenesis
rde00052  Galactose metabolism
rde01100  Metabolic pathways
rde01110  Biosynthesis of secondary metabolites
rde01120  Microbial metabolism in diverse environments
rde01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:rde00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RD1_3109 (galM)
   00052 Galactose metabolism
    RD1_3109 (galM)
Enzymes [BR:rde01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     RD1_3109 (galM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: ABG32618
RoseoBase: RD1_3109
UniProt: Q164H5
Position
2987282..2988250
Genome map
AA seq 322 aa AA seqDB search
MISLRSASLTAQILPFGATLAGLWLDGHPDSLVIGSSDAEAYTDHLRYFGAVIGPIANRI
SGAALQIGGAAFSMEANEGSACLHSGASGLHARMWTVLRCSAAAVSLRCELPDGANGLPG
NRRVEAHYELTDDGQLVLELTAQSDRATAINLAHHPYWNLGNADTIQNHHLMVYADTYLP
VDQQILPTGEIAPVAQTAYDFQTLRAIPIDRTLDANLCLAKIRRARPEPAARLRGPSGVT
LQIDTTEPGLQIYNGSSLHDVPISLHDQRVLRPFSGIALEPQGWPDAPHNRAFPSIVLRP
GQTYRQKTIYRIWHELSEPATF
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgatttcgctgcgctccgcatcgctgaccgctcagattctgccttttggcgcgaccttg
gcagggctttggcttgacgggcatcccgacagcctcgtgatcggctcatccgatgcagag
gcttacacggaccacctgcgctattttggtgccgtcatcggcccgattgcaaaccggatt
tccggtgcggcgctccagattgggggcgctgcgttcagtatggaagcgaatgaaggcagc
gcctgcctgcacagcggggccagcgggctgcacgcacgcatgtggacagtcttgcggtgt
tcagcggcggccgtctccttgcgatgcgagttgccagatggcgcaaatgggctgcccggc
aatcggagagttgaggcacattacgagctgacggatgatggccagttggtgctcgaactg
acggcgcaaagcgaccgcgcaacggccatcaatctcgcgcatcacccctattggaacctt
ggcaacgcagacaccatacagaaccaccatctgatggtttacgcggatacctacctgccg
gtcgaccaacaaatcctgccgacaggtgaaatcgcgcctgttgcgcaaacagcctatgat
tttcaaaccctgcgggcgatcccaatcgaccgaacactggatgcgaacttatgccttgcc
aaaatacggcgcgcgcgccccgaaccggctgcgcgcttgcgcggtccgtcaggtgtgacc
ctgcaaatcgacaccacggaaccgggactgcaaatctacaatggcagcagtttacacgat
gtgcctatttcacttcatgatcaacgtgttctgaggcccttttcaggtatcgcattagag
ccgcaaggctggcctgacgcgccacacaaccgcgcttttcccagcattgttttacgcccg
ggtcagacataccggcaaaaaacgatctatcggatttggcacgaattgagcgaacccgcc
acattctga

DBGET integrated database retrieval system