KEGG   Roseobacter denitrificans: RD1_3130Help
Entry
RD1_3130          CDS       T00376                                 

Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
rde  Roseobacter denitrificans
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rde00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    RD1_3130
Enzymes [BR:rde01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     RD1_3130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RoseoBase: 
UniProt: 
Position
complement(3006356..3007306)
Genome map
AA seq 316 aa AA seqDB search
MAGKNQPISGNDLARFSGPNSFMRLPMVNDLKGLDVAIVGIPMDIGTSWRSGTRFGPKEV
RAESAMIRPYNMGTGAAPFDSLQVADIGDLAINTFSLAKSLKIIEESYHAILNYDAMPLA
IGGDHSITLPILRAMHKRHGPVALVHVDAHADVNDEMFGEKETHGTVFRRAYEEGLILPD
KTYQVGLRGTGYTADDFAEARAWGFQQFPAQELWHRSLTGLGGEIRRDIGSKTPVYVSYD
IDSLDPAFAPGTGTPEIGGLTTPQAMELIRALKGLNIVGADLVEVSPPYDASGNTALVGA
NILFELICALPGVAYR
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atggcaggcaaaaaccaaccgatcagcgggaatgatctggcgcgtttttcggggccgaac
agtttcatgcgtttgcccatggtcaatgacctcaaggggctggatgtggctattgttggt
attccgatggatattggcacgtcctggcggtcaggcacgcggttcggccccaaagaggta
cgcgccgaaagcgcgatgatacggccctataacatgggaacgggtgcggccccctttgac
agcctgcaggtggcagatatcggcgatctggccatcaatacgttttccttggccaagagc
ctcaagatcatcgaggaaagctatcacgccatcctgaattatgatgcgatgccgctggcc
atcggcggggatcattcgatcacgctgccgatcttgcgcgccatgcacaaacgtcacggc
cctgttgcgctggtgcatgtggatgcgcatgcggatgtaaacgatgagatgttcggcgag
aaggaaacccacggcaccgtctttcgccgcgcctatgaggaagggctgatcctgcctgac
aaaacctatcaggtgggcttgcggggcacgggctacacggcagacgactttgccgaggcg
cgtgcatggggctttcagcagtttccggcgcaagagctttggcatcgcagcctgaccggg
ctggggggtgaaatccgccgcgatatcgggtccaaaacgcctgtctatgtcagctatgac
atcgacagcctcgacccggcctttgcgcccggcaccggcacgcccgagatcggcggcctc
acgacgcctcaggcgatggaactgatccgcgccctcaagggattgaatatcgttggcgct
gatcttgtggaggtgtcgccgccctatgacgccagcggcaataccgcgctggtgggcgca
aatatcctgttcgagcttatatgtgctctgccgggtgttgcctatcgctga

DBGET integrated database retrieval system