KEGG   Roseobacter denitrificans: RD1_3131Help
Entry
RD1_3131          CDS       T00376                                 

Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
rde  Roseobacter denitrificans
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:rde00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RoseoBase: 
UniProt: 
Position
complement(3007306..3008274)
Genome map
AA seq 322 aa AA seqDB search
MGLEDAKTEVDQAFTRADLKGPSFENTFGGATSFLRRKYTKDLSLADIAITGVPFDQAVT
NRPGTRLGPRAIREASALQPYDPPYGWPFDVLSEFAIIDYGDLAFDYGNVAAFPETLKAH
ISTILAADVPTVTLGGDHYVTYPILKAYAEKYGPISLLQFDAHSDSWPDDEESRVDHGTF
VYKAIKQGIVDAATSVQVGIRTTNEDTLGVTTIDAREVHRIGPEATVAKIKAVLGDNPVY
LTFDIDALDPAFAPGTGTPVWGGLTSAQAAAILRDLAGINIVGGDIVEVSPPFDTTGATA
IAGAHVATEILCLLGWKMRGGA
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgggactggaagacgccaagaccgaagtagaccaagcatttacgcgcgccgatctcaag
gggccaagttttgaaaacacgttcggcggggccacgtcatttctgcgccgcaaatacacc
aaggatctgtcgctcgccgatattgcaataacgggcgtgccctttgatcaggcggtcaca
aatcgcccaggcacccgtctggggccacgcgccatccgtgaggcgagcgcgctgcaaccc
tacgatccgccctatgggtggccgtttgatgtactgagcgaatttgcgatcattgattac
ggtgacttggcgtttgactatgggaatgtcgcggcctttcccgaaacgctgaaggcgcat
atcagcaccattcttgcagcagatgtgccaacggtcacgctggggggggatcactatgtg
acctatccgatcctcaaggcctatgcagagaaatacggccccatcagcctgttgcagttt
gatgcccattcagacagctggccggatgacgaggaaagtcgcgttgaccacggcaccttc
gtctacaaggccatcaagcagggcatcgtcgatgcggccacgtcggtgcaggtggggatc
cgcaccaccaatgaagacacgcttggggtcacgacgattgacgcgcgcgaagttcaccgc
atcggaccggaagcgaccgttgcgaaaatcaaggcggtgctgggggacaaccctgtctat
ctgacgttcgatatcgacgcgctggatccggcctttgcgccgggcacgggcacgcctgtc
tggggggggctgacctcggcgcaggcggccgccattctgcgtgatctggcggggatcaac
atcgtgggcggcgatattgtcgaggtctcccccccctttgacaccacaggggcaaccgct
atagcaggcgcgcatgtggcaacagaaatactgtgcctactgggctggaagatgcgaggg
ggtgcgtga

DBGET integrated database retrieval system