KEGG   Roseobacter denitrificans: RD1_3163Help
Entry
RD1_3163          CDS       T00376                                 

Gene name
nagZ
Definition
beta-hexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
rde  Roseobacter denitrificans
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:rde00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:rde00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RoseoBase: 
UniProt: 
Position
complement(3034827..3035825)
Genome map
AA seq 332 aa AA seqDB search
MARFGATILDAEGLRLTADEKAFFRAANPYGFILFARNIDTPDQVRALCAEMRACVGRDA
PITIDQEGGRVQRLRGPVWTEWLPPLDFVARAGSRAKEAMYLRYRLIAAELHDLGIDCNC
APMVDIASADTHEFLRNRCYGTDADSVAMLGRAAADGMLAGGVIPVLKHIPGHGRATLDS
HYDLPRVTASAADLHAHDFAPFKALNDLPMGMTAHLVYEALDGAPATLSPKVMQTIREDI
GFDNLIMTDDISMKALSGSLPDIAKSALAAGCDVVLHCNGTLAQRHAVADAAGEMRFAAQ
TRALRALNARIAPDDIDIPAAQAQLETLLNQA
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
gtggcgcggttcggagccactattcttgacgctgaagggctacgcctgacggcggatgaa
aaggcgttctttcgggccgccaacccttatggatttatcctctttgcccgcaacattgac
acgccggatcaggtgcgcgcgctttgtgcggagatgcgcgcctgcgtcgggcgcgatgcc
cctatcaccattgatcaggaaggcgggcgcgtgcagcggttgcgcggcccggtctggaca
gaatggctgcccccgctggatttcgtagcgagggcgggttcgcgcgccaaagaggcgatg
tatctgcgctatcgcctgatcgcggcggagttgcatgatcttggcatcgactgcaattgc
gccccaatggtcgatatcgcgagtgccgatacccatgaattcctgcgcaaccggtgttat
ggcacggatgccgacagtgtggcgatgctgggccgcgcggcggcggatgggatgctggca
ggcggggttatcccggtgctcaaacacatccccggacacgggcgtgcaaccttggacagt
cactatgatctgccgcgggtcacggcctcggcggctgatttgcatgcacatgattttgcc
cccttcaaagcgctgaacgatctgcccatggggatgaccgcgcatctggtctatgaggcg
cttgacggcgcgcccgcgacgctctcgcccaaggtcatgcaaaccatccgtgaggacatc
gggtttgacaacctgatcatgacggatgacatctcgatgaaggcgctgtcggggtcgcta
cctgacatcgcaaaatccgcgctcgctgccgggtgcgatgtggtgttgcattgcaacgga
acgcttgcgcagcgccacgccgtcgccgatgcggcaggcgagatgcgttttgccgcccag
acccgtgcgttgcgcgccctgaatgcgcggatcgcccctgacgatattgacattcccgcc
gcgcaggctcagcttgagacgctgttgaaccaggcgtga

DBGET integrated database retrieval system