KEGG   Roseobacter denitrificans: RD1_3163Help
Entry
RD1_3163          CDS       T00376                                 

Gene name
nagZ
Definition
beta-hexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
rde  Roseobacter denitrificans
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rde00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    RD1_3163 (nagZ)
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    RD1_3163 (nagZ)
Enzymes [BR:rde01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     RD1_3163 (nagZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RoseoBase: 
UniProt: 
Position
complement(3034827..3035825)
Genome map
AA seq 332 aa AA seqDB search
MARFGATILDAEGLRLTADEKAFFRAANPYGFILFARNIDTPDQVRALCAEMRACVGRDA
PITIDQEGGRVQRLRGPVWTEWLPPLDFVARAGSRAKEAMYLRYRLIAAELHDLGIDCNC
APMVDIASADTHEFLRNRCYGTDADSVAMLGRAAADGMLAGGVIPVLKHIPGHGRATLDS
HYDLPRVTASAADLHAHDFAPFKALNDLPMGMTAHLVYEALDGAPATLSPKVMQTIREDI
GFDNLIMTDDISMKALSGSLPDIAKSALAAGCDVVLHCNGTLAQRHAVADAAGEMRFAAQ
TRALRALNARIAPDDIDIPAAQAQLETLLNQA
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
gtggcgcggttcggagccactattcttgacgctgaagggctacgcctgacggcggatgaa
aaggcgttctttcgggccgccaacccttatggatttatcctctttgcccgcaacattgac
acgccggatcaggtgcgcgcgctttgtgcggagatgcgcgcctgcgtcgggcgcgatgcc
cctatcaccattgatcaggaaggcgggcgcgtgcagcggttgcgcggcccggtctggaca
gaatggctgcccccgctggatttcgtagcgagggcgggttcgcgcgccaaagaggcgatg
tatctgcgctatcgcctgatcgcggcggagttgcatgatcttggcatcgactgcaattgc
gccccaatggtcgatatcgcgagtgccgatacccatgaattcctgcgcaaccggtgttat
ggcacggatgccgacagtgtggcgatgctgggccgcgcggcggcggatgggatgctggca
ggcggggttatcccggtgctcaaacacatccccggacacgggcgtgcaaccttggacagt
cactatgatctgccgcgggtcacggcctcggcggctgatttgcatgcacatgattttgcc
cccttcaaagcgctgaacgatctgcccatggggatgaccgcgcatctggtctatgaggcg
cttgacggcgcgcccgcgacgctctcgcccaaggtcatgcaaaccatccgtgaggacatc
gggtttgacaacctgatcatgacggatgacatctcgatgaaggcgctgtcggggtcgcta
cctgacatcgcaaaatccgcgctcgctgccgggtgcgatgtggtgttgcattgcaacgga
acgcttgcgcagcgccacgccgtcgccgatgcggcaggcgagatgcgttttgccgcccag
acccgtgcgttgcgcgccctgaatgcgcggatcgcccctgacgatattgacattcccgcc
gcgcaggctcagcttgagacgctgttgaaccaggcgtga

DBGET integrated database retrieval system