KEGG   Roseobacter denitrificans: RD1_3325Help
Entry
RD1_3325          CDS       T00376                                 

Gene name
glcB
Definition
(GenBank) malate synthase G
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
rde  Roseobacter denitrificans
Pathway
rde00620  Pyruvate metabolism
rde00630  Glyoxylate and dicarboxylate metabolism
rde01100  Metabolic pathways
rde01110  Biosynthesis of secondary metabolites
rde01120  Microbial metabolism in diverse environments
rde01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rde00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    RD1_3325 (glcB)
   00630 Glyoxylate and dicarboxylate metabolism
    RD1_3325 (glcB)
Enzymes [BR:rde01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     RD1_3325 (glcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: ABG32824
RoseoBase: RD1_3325
UniProt: Q163L9
Position
complement(3188847..3190994)
Genome map
AA seq 715 aa AA seqDB search
MTGFQTRHELQVADVLVSFIEESALPGTDIKASDFWKGLSDLVHEFGPENRALLEQRAAI
QSKIDDWHIAHRDQPHDHEAYSAFLREIGYLVEEGPDFEIDTANVDPEIASVPGPQLVVP
ITNARYALNAANARWGSLYDGFYGTDAMGSPAPKGGYDQGRGARVVARARVFLDEAFPIV
GTSHADARRYIVHKGALLVDDQPLVSPEKFIGYTGHPKAPDSIVLRNNGLHVKLVFDRTH
AIGGRDQAGLADVQMESAVSAIMDCEDSVACVDAEDKVVAYANWLGLMKGDLEESFEKGG
QTLTRRLNGDLTLTGPDDGEVVLKGRALMLVRNVGHLMTNPAILDRDGNEVFEGLMDAMI
TTLIAMHDLKRAGGNSLTGSVYVVKPKMHGPQEVAFADRTFTHVENVLGLPQYTVKLGIM
DEERRTSVNLKECIRAAKSRVAFINTGFLDRTGDEIHTSMEAGPFSRKDFIKRKAWIGAY
ENQNVDIGLECGLSGRAQIGKGMWAMPDLMAAMLEQKIEHPKSGANCAWVPSPTAATLHA
LHYHKVDVFAVQQKLRAGGRRAYVDTVLDIPLATYQKWTPEQVRREVENNAQGILGYVVR
WVDQGVGCSKVPDMNDVGLMEDRATCRISAQHIANWLHHGVVDAQDVMAALRKMAQVVDA
QNADDPLYVPMAPGFDGIAFQAACDLVFKGRVQPSGYTEPVLHARRLELKARAQG
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atgaccggatttcagaccagacatgaactgcaggtcgctgatgtacttgtctctttcata
gaagaaagcgcattgcccggcacagacataaaggcgtctgatttctggaaagggctgtcg
gaccttgtgcatgagtttggcccggaaaaccgcgcattgctggaacagcgcgcggccatt
cagtccaagatcgatgactggcacatcgcacatcgcgaccagccccatgaccacgaggcc
tattccgcgtttctgcgcgagatcgggtatctggttgaagagggtcccgactttgaaatc
gacacggcgaatgttgatcccgagattgccagcgtgccgggtccgcagcttgtggtgccc
atcaccaatgcacgttacgcgctgaatgcggcgaacgcgcgttggggcagcttgtatgac
gggttttatggcaccgatgccatgggctctccggcgcccaagggtgggtatgatcagggg
cgcggtgcgcgcgtggttgcacgtgcgcgggtgtttctggacgaggcgtttccgattgtc
gggaccagtcacgccgatgcgcgccgctacatcgtgcacaaaggggccttgctggtggac
gaccaaccccttgtcagcccggaaaaattcatcggttacacgggccatcccaaagcgccc
gacagcattgttctgcgtaacaatggcttgcacgtgaaactggtctttgaccgcacccat
gccattggtgggcgcgatcaggcagggcttgccgatgtgcagatggaaagtgcggtctcc
gcgatcatggattgcgaggattccgtcgcctgtgtggatgccgaagataaagtcgtcgcc
tatgccaactggcttggcctgatgaagggcgacctcgaggaatcctttgaaaagggcggt
cagacgctgacccggcggctcaacggtgatctgaccctgaccgggccggacgacggggag
gtcgtattgaaaggccgggccttgatgttggtgcgcaatgtcggtcatctgatgaccaac
ccggccattcttgatcgcgacggcaacgaggtctttgagggcctgatggacgccatgatc
accacgttgatcgcgatgcatgatctcaagcgggcggggggcaattcgctgaccgggtcc
gtctatgtggtcaaacccaagatgcacggacctcaggaggtcgcctttgcggatcgcacg
ttcacgcatgtcgagaacgtgcttggcctgccgcaatacacggtcaagctgggcatcatg
gatgaagagcggcgcacgtccgtgaacctgaaagaatgcattcgcgccgccaaatcgcgg
gtcgctttcatcaataccgggttcctggaccggacgggcgatgaaatccacacctcgatg
gaggcagggcccttcagccgcaaggacttcatcaagcgcaaggcgtggattggcgcctat
gaaaaccagaacgtggatatcggtctggaatgtggtctttcggggcgcgcgcagatcggc
aagggcatgtgggccatgccggaccttatggccgcgatgctggagcaaaagatcgaacac
cccaaatcaggggcaaactgtgcctgggtgcccagcccgacggcggcgacgctgcatgcg
ctgcattatcacaaggtcgacgtctttgcggtgcagcaaaaactgcgcgcgggcgggcgg
cgggcctatgtggacacggtgctggatattccgctggcaacctatcagaaatggacaccg
gaacaggtgcgccgcgaagttgagaacaatgcgcagggaattctgggctatgtggtgcgc
tgggtcgatcagggggttgggtgttccaaagtaccggatatgaacgatgtgggcctgatg
gaggaccgcgccacctgtcgtatttcggcgcagcatatcgcgaactggctgcatcacggt
gttgtggatgcgcaggacgtgatggccgcgctgcgcaagatggcgcaggtggtggatgcg
cagaacgcagacgatccgctctatgtgccgatggctccgggatttgacggcatcgcgttt
caggcggcgtgcgatctggtgttcaagggtcgtgtgcagccatcgggctatacggaaccg
gttctgcacgcacgtcggcttgagttgaaggcccgggcgcagggctga

DBGET integrated database retrieval system