KEGG   Roseobacter denitrificans: RD1_3402Help
Entry
RD1_3402          CDS       T00376                                 

Gene name
ispE
Definition
(GenBank) 4-diphosphocytidyl-2C-methyl-D-erythritol kinase, putative
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
rde  Roseobacter denitrificans
Pathway
rde00900  Terpenoid backbone biosynthesis
rde01100  Metabolic pathways
rde01110  Biosynthesis of secondary metabolites
rde01130  Biosynthesis of antibiotics
Module
rde_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:rde00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    RD1_3402 (ispE)
Enzymes [BR:rde01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     RD1_3402 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_C GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: ABG32894
RoseoBase: RD1_3402
UniProt: Q163E9
Position
complement(3266682..3267581)
Genome map
AA seq 299 aa AA seqDB search
MSMPVPQVVEVFAPAKINLTLHVTGQRPDGYHLLDSLVAFADVGDVLRLEPADVWQMKTV
GPEAEAVPDGAENLVLKAAALLDGAPKAAFTLTKNLPVASGIGGGSADAAAAFRGLCAAT
PHHDPNNIDTQRRLLSLGADIPMCLHCVTARITGIGEEITPVAQFPALHAVLINPRVAVS
TPAVFKAMKQRNNPPMPDIPPESCDVKDLVEWLRAQRNDMQEAATTLEPAIATVQAALEG
HRACQLARMSGSGATCFGLFHTAQAAQQAARDLSRDYPQWWIRPTQLGSQAERAVPRLS
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgtccatgccggtgccgcaggtcgtcgaggtctttgccccggcaaaaatcaatctcacc
cttcatgtcacggggcagcgacccgatggctaccacctgcttgatagtctggtcgccttt
gcggatgtgggggatgtgctgcgtcttgaaccggctgacgtctggcagatgaaaactgtg
ggacccgaggcggaggcggttccggatggggcggaaaaccttgtcctgaaagccgcggcg
ctgcttgatggcgcgccaaaagctgcctttaccctgacgaagaacctgcccgtggcctct
ggtattgggggcgggtctgctgacgccgctgccgcctttcgcgggctgtgcgccgcaacc
ccgcatcatgacccaaacaacattgatacacagcggcgacttctgtcgcttggggctgat
attccgatgtgtctgcactgcgtgacagcccggatcacaggaatcggtgaagagatcacg
ccggtggcgcagtttccggccctgcacgctgtgctcatcaacccccgcgtcgccgtctca
acgcccgccgttttcaaagcgatgaagcagcggaacaatccgccaatgcccgatatcccg
ccggaatcttgtgacgtgaaagaccttgtggaatggctgcgtgcgcaacgcaacgacatg
caagaggccgcaacgacgctggaacctgccatcgcaaccgttcaggccgcgcttgagggg
cacagggcgtgtcagttggcgcgcatgtccggctcaggtgcgacctgctttgggctgttt
cataccgcgcaggcagcgcagcaggctgcgcgcgatttgtcccgcgattatccgcagtgg
tggatcaggcccacgcagcttggatcacaggccgaacgcgcagtaccccgtctcagttga

DBGET integrated database retrieval system