KEGG   Roseobacter denitrificans: RD1_3427Help
Entry
RD1_3427          CDS       T00376                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
rde  Roseobacter denitrificans
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:rde00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:rde00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RoseoBase: 
UniProt: 
Position
3292065..3293063
Genome map
AA seq 332 aa AA seqDB search
MPMAQPLPIRWKIAIGWPMTFPHRHLLGIEALRPEEINTLLDLADKYAALNRQPDKHADA
LKGLTQINMFFENSTRTQASFEIAGKRLGADVMNMAMQASSVKKGETLIDTALTLNAMHP
DLLVVRHPQSGAVDLLAQKVNCAVLNAGDGRHEHPTQALLDALTIRRAKGRLHRLSIAIC
GDIAHSRVARSNIMLLGKMENRIRLIGPPTLMPSGISEFGVEVFNDMNAGLKDVDVVMML
RLQKERMDGGFIPSEREYYHRFGLDADKLSNAKPDAIIMHPGPMNRGVEIDGTLADDINR
SVIQDQVEMGVAVRMAAMDLLSQNLRLTRGAE
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
ttgccgatggcacaacccctgcctataaggtggaaaatcgcaataggttggcccatgaca
tttccgcaccgacacctgcttggtatcgaggctcttcgcccggaagagatcaatactctg
cttgatctggcggacaaatacgcagcgctgaaccgacagcccgacaaacacgccgatgcc
ctcaagggtctgacgcaaatcaacatgttcttcgaaaattcgacccgcacgcaggcgagt
ttcgagatcgcgggcaagcggcttggcgcggatgtgatgaacatggcgatgcaggccagt
tcggtcaaaaagggcgaaacgctgattgacaccgcgctcaccctgaatgcgatgcaccct
gatttgctggtggtgcggcacccgcaatcgggtgctgtggatctcttggcgcaaaaagtg
aactgtgccgtactgaacgcgggcgatgggcgccatgaacacccgacgcaggccctgctg
gatgcgctgacgatccggcgtgccaaggggcgcttgcatcgcctgtccatcgcgatctgt
ggcgatattgcgcacagccgcgtggcgcgctccaacatcatgctgctgggcaagatggaa
aaccgcatacgtctgatcggcccgccgaccctgatgcccagcggtatttccgagttcggc
gtcgaggtgttcaacgatatgaacgcgggcctgaaagacgtcgatgtggtgatgatgctg
cgtctgcaaaaagaacgtatggatggcgggttcatcccctctgaacgtgaatactaccac
cgcttcgggctggatgcggataagctgtccaacgccaaaccggatgcgatcatcatgcac
cccggccccatgaacaggggcgttgagattgacgggacgctggccgatgacatcaaccgc
agcgtcatccaggatcaggtcgaaatgggtgtcgcagtgcgcatggccgcgatggatctg
ctgtctcaaaacctaagactaacgcgaggtgctgaatga

DBGET integrated database retrieval system