KEGG   Roseobacter denitrificans: RD1_3427Help
Entry
RD1_3427          CDS       T00376                                 

Gene name
pyrB
Definition
(GenBank) aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
rde  Roseobacter denitrificans
Pathway
rde00240  Pyrimidine metabolism
rde00250  Alanine, aspartate and glutamate metabolism
rde01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rde00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    RD1_3427 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    RD1_3427 (pyrB)
Enzymes [BR:rde01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     RD1_3427 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace Fer2_4
Motif
Other DBs
NCBI-ProteinID: ABG32918
RoseoBase: RD1_3427
UniProt: Q163C5
Position
3292065..3293063
Genome map
AA seq 332 aa AA seqDB search
MPMAQPLPIRWKIAIGWPMTFPHRHLLGIEALRPEEINTLLDLADKYAALNRQPDKHADA
LKGLTQINMFFENSTRTQASFEIAGKRLGADVMNMAMQASSVKKGETLIDTALTLNAMHP
DLLVVRHPQSGAVDLLAQKVNCAVLNAGDGRHEHPTQALLDALTIRRAKGRLHRLSIAIC
GDIAHSRVARSNIMLLGKMENRIRLIGPPTLMPSGISEFGVEVFNDMNAGLKDVDVVMML
RLQKERMDGGFIPSEREYYHRFGLDADKLSNAKPDAIIMHPGPMNRGVEIDGTLADDINR
SVIQDQVEMGVAVRMAAMDLLSQNLRLTRGAE
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
ttgccgatggcacaacccctgcctataaggtggaaaatcgcaataggttggcccatgaca
tttccgcaccgacacctgcttggtatcgaggctcttcgcccggaagagatcaatactctg
cttgatctggcggacaaatacgcagcgctgaaccgacagcccgacaaacacgccgatgcc
ctcaagggtctgacgcaaatcaacatgttcttcgaaaattcgacccgcacgcaggcgagt
ttcgagatcgcgggcaagcggcttggcgcggatgtgatgaacatggcgatgcaggccagt
tcggtcaaaaagggcgaaacgctgattgacaccgcgctcaccctgaatgcgatgcaccct
gatttgctggtggtgcggcacccgcaatcgggtgctgtggatctcttggcgcaaaaagtg
aactgtgccgtactgaacgcgggcgatgggcgccatgaacacccgacgcaggccctgctg
gatgcgctgacgatccggcgtgccaaggggcgcttgcatcgcctgtccatcgcgatctgt
ggcgatattgcgcacagccgcgtggcgcgctccaacatcatgctgctgggcaagatggaa
aaccgcatacgtctgatcggcccgccgaccctgatgcccagcggtatttccgagttcggc
gtcgaggtgttcaacgatatgaacgcgggcctgaaagacgtcgatgtggtgatgatgctg
cgtctgcaaaaagaacgtatggatggcgggttcatcccctctgaacgtgaatactaccac
cgcttcgggctggatgcggataagctgtccaacgccaaaccggatgcgatcatcatgcac
cccggccccatgaacaggggcgttgagattgacgggacgctggccgatgacatcaaccgc
agcgtcatccaggatcaggtcgaaatgggtgtcgcagtgcgcatggccgcgatggatctg
ctgtctcaaaacctaagactaacgcgaggtgctgaatga

DBGET integrated database retrieval system