KEGG   Roseobacter denitrificans: RD1_3610Help
Entry
RD1_3610          CDS       T00376                                 

Gene name
thiM
Definition
(GenBank) hydroxyethylthiazole kinase
  KO
K00878  
hydroxyethylthiazole kinase [EC:2.7.1.50]
Organism
rde  Roseobacter denitrificans
Pathway
Thiamine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rde00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    RD1_3610 (thiM)
Enzymes [BR:rde01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.50  hydroxyethylthiazole kinase
     RD1_3610 (thiM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
RoseoBase: 
UniProt: 
Position
3473809..3474582
Genome map
AA seq 257 aa AA seqDB search
MAPHDLLTALRDQNPLVHCITNYVAMNIAANVVLAAGASPAMVHAPEEIAEFTPICGALT
INIGTISTPWQASMMAAAATASAQNIPWVLDPVAHFISVYRREAAQQLLAQRPTILRGNA
SEILALTGETGAGKGADSGDSVDAAQGAAKKLAAQFGTVVAITGPVDYLTDGTREAQVSG
GSSLMPQVTALGCSQTALMGAYAATGPAFDAALAALAHFKVAGSTAAQRADGPGSFQMHF
LDALANTQPFELAQVIR
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atggctccacacgacctgctgacggctttgcgcgaccagaaccctttggtgcactgcata
acgaattacgtggcgatgaacatcgccgcgaacgtggtcctggcagcgggcgcatcgcct
gccatggtgcacgcccccgaagaaattgccgaatttacgccgatttgcggtgcgctgacg
atcaacatcggaacgatttccaccccctggcaggccagcatgatggcggcggcagcaaca
gcgagcgcgcaaaacatcccatgggttctggaccctgttgcacatttcatttccgtatat
cgaagagaagcggcccagcaactgcttgcgcagcgccccacgatcctgcgcggcaatgcc
tccgagatactggcgctgaccggggaaacgggggccggtaaaggtgcggacagcggggac
agtgtagacgcagcacaaggcgcggcgaaaaagctggcggcacagttcggcacagtcgtc
gcaatcaccggacccgttgattatctgaccgacggcacgcgggaagcgcaggtttccggc
ggctcgtccctgatgccgcaggtcacggctttgggctgttcacagacggcgctgatgggc
gcatatgcggccacaggcccggcctttgacgcagcgctggccgcacttgcgcatttcaag
gtagcaggcagcacggctgcacagcgcgccgacgggccgggcagtttccagatgcatttt
ctggacgcgcttgccaatacgcaaccttttgaactggcgcaggtcataagatga

DBGET integrated database retrieval system