KEGG   Roseobacter denitrificans: RD1_3625Help
Entry
RD1_3625          CDS       T00376                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
rde  Roseobacter denitrificans
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:rde00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RD1_3625 (tpiA)
   01230 Biosynthesis of amino acids
    RD1_3625 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RD1_3625 (tpiA)
   00051 Fructose and mannose metabolism
    RD1_3625 (tpiA)
   00562 Inositol phosphate metabolism
    RD1_3625 (tpiA)
Enzymes [BR:rde01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     RD1_3625 (tpiA)
Exosome [BR:rde04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   RD1_3625 (tpiA)
  Exosomal proteins of bladder cancer cells
   RD1_3625 (tpiA)
  Exosomal proteins of melanoma cells
   RD1_3625 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RoseoBase: 
UniProt: 
Position
complement(3489125..3489901)
Genome map
AA seq 258 aa AA seqDB search
MSEPSFWIGTSWKMNKTLAEGLDFARALAAADSARDPRIQRFVVPPFPMVRDIKAALADT
SVKVGAQNMHWEDAGAWTGEVSAPMLVDCGLDLVELGHSERRAHFGETDETVGLKVAAAV
RHGLIPLICIGETLEEREAGRAKEVLAAQVSAALARVTGSAPVLLAYEPVWAIGEHGIPA
TSDYADARQAEIIDVAGEMLGRRVPCLYGGSVNQDNCEELIRCPHIDGLFIGRAAWDATG
YLKILEKSAATLDLGETT
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaccgtctttttggattggcaccagctggaagatgaacaagacccttgccgag
gggctggattttgcccgtgcactcgccgcagcggacagtgcgcgtgatccgcgcatccag
cggttcgttgtgccaccctttccgatggtgcgggacatcaaggccgccttggccgatacc
tcggtcaaggtcggggcgcagaatatgcattgggaggacgcaggcgcgtggaccggcgaa
gtttccgcgccgatgcttgtggattgcggcctcgaccttgtggaactgggccactccgag
cggcgcgcgcattttggcgaaacggatgagaccgtggggctgaaggtggcggccgccgtg
cgacacgggttgatccccttgatctgcatcggcgaaacgctggaggaacgcgaggcgggg
cgcgccaaagaggtgctggcagcgcaggtcagcgccgcgctggcgcgcgttaccggcagc
gcgccggttttgctggcctatgaaccggtctgggcgattggtgaacacggcatccccgcg
acatcggactatgccgacgcgcgtcaggccgagatcatcgacgttgctggcgaaatgctg
gggcggcgggtgccctgcctatacggcggttcggtcaatcaggacaattgcgaggaattg
atccgctgcccgcatatcgacgggctgttcatcgggcgcgcggcatgggacgcgaccggc
tatctgaaaattctggaaaaatctgcggcaaccttggacttgggagaaacgacatga

DBGET integrated database retrieval system