KEGG   Roseobacter denitrificans: RD1_3625Help
Entry
RD1_3625          CDS       T00376                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K21910  
L-erythrulose 1-phosphate isomerase [EC:5.3.1.33]
Organism
rde  Roseobacter denitrificans
Brite
Enzymes [BR:rde01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.33  L-erythrulose 1-phosphate isomerase
     RD1_3625 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
RoseoBase: 
UniProt: 
Position
complement(3489125..3489901)
Genome map
AA seq 258 aa AA seqDB search
MSEPSFWIGTSWKMNKTLAEGLDFARALAAADSARDPRIQRFVVPPFPMVRDIKAALADT
SVKVGAQNMHWEDAGAWTGEVSAPMLVDCGLDLVELGHSERRAHFGETDETVGLKVAAAV
RHGLIPLICIGETLEEREAGRAKEVLAAQVSAALARVTGSAPVLLAYEPVWAIGEHGIPA
TSDYADARQAEIIDVAGEMLGRRVPCLYGGSVNQDNCEELIRCPHIDGLFIGRAAWDATG
YLKILEKSAATLDLGETT
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaccgtctttttggattggcaccagctggaagatgaacaagacccttgccgag
gggctggattttgcccgtgcactcgccgcagcggacagtgcgcgtgatccgcgcatccag
cggttcgttgtgccaccctttccgatggtgcgggacatcaaggccgccttggccgatacc
tcggtcaaggtcggggcgcagaatatgcattgggaggacgcaggcgcgtggaccggcgaa
gtttccgcgccgatgcttgtggattgcggcctcgaccttgtggaactgggccactccgag
cggcgcgcgcattttggcgaaacggatgagaccgtggggctgaaggtggcggccgccgtg
cgacacgggttgatccccttgatctgcatcggcgaaacgctggaggaacgcgaggcgggg
cgcgccaaagaggtgctggcagcgcaggtcagcgccgcgctggcgcgcgttaccggcagc
gcgccggttttgctggcctatgaaccggtctgggcgattggtgaacacggcatccccgcg
acatcggactatgccgacgcgcgtcaggccgagatcatcgacgttgctggcgaaatgctg
gggcggcgggtgccctgcctatacggcggttcggtcaatcaggacaattgcgaggaattg
atccgctgcccgcatatcgacgggctgttcatcgggcgcgcggcatgggacgcgaccggc
tatctgaaaattctggaaaaatctgcggcaaccttggacttgggagaaacgacatga

DBGET integrated database retrieval system