KEGG   Roseobacter denitrificans: RD1_3715Help
Entry
RD1_3715          CDS       T00376                                 

Gene name
gtfA
Definition
sucrose phosphorylase (EC:2.4.1.7)
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
rde  Roseobacter denitrificans
Pathway
Starch and sucrose metabolism
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:rde00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RoseoBase: 
UniProt: 
Position
complement(3584915..3586642)
Genome map
AA seq 575 aa AA seqDB search
MRLASLVRQIYPDIDADILSSKIVEAFWPEGTKPRKRGRLPGNNLWTEKDALLITYGNSI
LDGSHKPLDLLHDFLLRYMKGVVNGVHILPFFPFTSDDGFAVSDFRAVNPQLGDWADINR
IGDAFHLMSDLVLNHVSSQGAWFNAYRQGQAPYDRFFFEASPDDDLSAVVRPRTTPLLQQ
VDTVNGPRHVWCTFSHDQIDLDFRNPEVLLEFLRIIRLHVDNGVQIIRLDAVAFLWKEVG
SSSIHLPQTHAIVQLMRMLCDYAAETIILLTETNVPKAENLSYFGNRNEAHAIYNFPLPP
LILHAMMSGSARYLRRWQSGMPPAQLGCAYLNFTASHDGIGMRPAEGVLPPQEQARMIQT
VRDIGGLVSMRALPDGGEAPYELNTTFFEATSRTFKGEDALHFDRFVCSQTIVMSLEGIP
AFYIHAMLATPNDHAQVARRGMNRAINRHRWDYPTLQAHLADTGSIHARVLAALSARLRL
RARQSAFHPNATQFTMALEDRVFGVWRQSLDRFQSIFALHNVSDEVVEIPAVSMNLIEDE
DWIDILSGEKIDTFADTIELAPYQCRWITNRAQPG
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atgcgcctcgcatcgctcgtccgccagatttaccccgacattgatgctgatatcctctcc
agcaagatcgttgaggcgttctggcccgagggcaccaagccgcgcaaacgcgggcgtttg
ccgggcaacaacctgtggacggaaaaagacgcgctgctgatcacctatggcaactctata
ctggacgggtctcacaagccgctggacctgctgcatgactttttgctgcgctacatgaaa
ggcgtggtcaatggcgtgcacatcctgccgttttttccattcacgtccgacgatggcttt
gcggtgtccgattttcgcgcggtgaacccgcagcttggcgactgggccgatatcaaccgg
atcggggatgcgtttcacctgatgtccgatctggtgctgaaccatgtgtccagtcagggc
gcgtggttcaatgcctaccggcaggggcaggcgccctatgatcgcttctttttcgaggcg
tcccccgatgatgatctgtcggcagttgtccggccccgcaccacgcctttgctgcaacaa
gtcgacacggtgaacgggccgcgccatgtctggtgtaccttcagccatgatcagattgat
ctggatttccgcaatccggaggtcttgctggaattcctgcgtatcatccggctgcatgtg
gacaacggggtgcagatcatccgcctcgatgcggttgcgtttttgtggaaggaggtggga
tcgtcatccatccatttgccccaaacacatgcgattgtgcagctgatgcgcatgctgtgc
gactacgcggcggagacgatcattctattgaccgagaccaacgtgcccaaggccgaaaat
ctcagttatttcgggaatcgcaacgaggcgcatgcgatttacaacttcccgctgccgccg
ctgatcctgcatgccatgatgtcggggtccgcgcggtatcttcggcgctggcaaagcggg
atgccgcccgcgcaactgggctgtgcctatctgaacttcacggccagccacgatgggatc
ggcatgcgccccgcagaaggggtgctaccgccgcaagagcaggcgcgcatgatccagacg
gtgcgcgacatcggagggcttgtgtcgatgcgcgcgctaccggatggcggcgaggcccct
tacgagttgaacacgaccttcttcgaggccacatcacgcactttcaaaggagaggatgcc
ctgcatttcgaccggtttgtctgttcgcagaccatcgtgatgtcgctggaaggaatcccc
gccttctacatccacgccatgctcgccactccgaatgatcacgcacaggtcgcgcggcgc
gggatgaaccgggcgatcaaccggcacagatgggattaccccactttgcaggcgcatctg
gcggataccgggtcgatacatgcgcgcgtgctcgcggccttgtccgcgcggttgcgtttg
cgggcgcgtcagtccgcgtttcaccccaatgccactcaattcaccatggcgttggaggat
cgggttttcggggtctggcgccaaagcctcgatcggtttcagtcgatctttgccctgcat
aacgtcagcgatgaggtcgttgaaatccccgctgtttccatgaacctcattgaggatgaa
gactggattgacattctgagcggtgaaaagatcgataccttcgcggatacgatcgaactc
gccccctatcaatgccggtggattaccaaccgggcgcaaccgggctga

DBGET integrated database retrieval system