KEGG   Roseobacter denitrificans: RD1_3765Help
Entry
RD1_3765          CDS       T00376                                 

Gene name
xylA
Definition
xylose isomerase (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
rde  Roseobacter denitrificans
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:rde00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:rde00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RoseoBase: 
UniProt: 
Position
complement(3646755..3647741)
Genome map
AA seq 328 aa AA seqDB search
MKDPNTPLFAARLNAFKIGADAYWPGKNTVTTADLLGRAATAGLTAADLNYPDHFVSDTP
AQLTEALQGNGMVLNGMAMRYYTDPGYKLGAFTHPDASVRRAAIDETKRGLDVLAQMGGR
LMTLWMGQDGFDYSFQMDYTRAWDHTITAITEVADHNPTLDIALEYKPNEPRAFALMPDA
ATTLLALREVDRPNTGVTLDFAHVLYADEMPAFAAALVARHSRILGVHLNDGYGKWDNGL
MVGAVHPVQTIELLVELTRAGYDGAIYFDTFPDHSGLDPVAEARTNIDVVNRLRAIAQGL
AGDADLQAAIARQDAPLSMRLVQAAMLK
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatcccaacacccccctttttgcagcccggctgaatgctttcaagatcggtgct
gacgcctattggcccggcaaaaacacggtcacaactgccgatctgctgggccgcgcggcc
acggcagggctgacagcggcggatttgaattaccccgatcacttcgtcagcgatacgcct
gcgcaactgaccgaggccttgcagggcaacggcatggtgctcaacggcatggccatgcgg
tactacaccgacccgggctataaactgggggccttcacgcatcccgatgccagcgtccgg
cgcgcggccatagatgaaaccaaacgcgggctcgatgtgctggcgcagatgggcgggcgt
ctgatgacgctctggatggggcaggacgggttcgattattcgttccagatggattacaca
cgcgcatgggaccacacgatcaccgcgatcactgaggttgccgatcacaacccgaccctt
gatatcgcgttggaatataaacccaatgagccgcgcgcctttgccctgatgcccgatgcg
gccacgacccttcttgcgctcagggaggttgaccggcccaataccggtgtaactcttgat
tttgcccatgtgctttatgccgacgagatgcccgcttttgccgccgccctcgtggcgcgt
cattcgcgcatcctcggtgtgcatcttaacgatggctacgggaaatgggacaacgggctg
atggtgggggccgtgcatccggtgcagaccattgaactgctcgtggaactgacgcgcgca
gggtatgatggggcgatttatttcgataccttcccggaccattccggtcttgacccggtg
gcagaggcgcgcaccaatatcgacgtggtgaaccggctgcgcgcgattgcgcaggggctt
gccggggatgctgatctgcaagcggccatcgcccgacaggatgcgcccctgtccatgcgg
ctggtacaggcggccatgctgaaatga

DBGET integrated database retrieval system