KEGG   Roseobacter denitrificans: RD1_3776Help
Entry
RD1_3776          CDS       T00376                                 

Gene name
glk
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
rde  Roseobacter denitrificans
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:rde00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RD1_3776 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RD1_3776 (glk)
   00052 Galactose metabolism
    RD1_3776 (glk)
   00500 Starch and sucrose metabolism
    RD1_3776 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    RD1_3776 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    RD1_3776 (glk)
   00524 Butirosin and neomycin biosynthesis
    RD1_3776 (glk)
Enzymes [BR:rde01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     RD1_3776 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RoseoBase: 
UniProt: 
Position
complement(3657297..3658244)
Genome map
AA seq 315 aa AA seqDB search
MVADIGGTNTRVALCDGVEVLKPTIRRYRNADNDGFTAVLAQYLAAEGNVQPRAVCVAIA
GPVSGGKGRLTNLDWDMDEAEIAKATGAKCVALLNDLQAQGYALDQLGPGDLARLRKGAA
TPKGDARLVVNLGTGFNASPVFMTQAGAYVATSESGHANMPIRTDQDLRLCAFIEERHGF
AAIDDILSGRGLERVFAFLAHEAGKNRLLNSAQIMSACADDRDELAVQTVRYFVRLTALV
IANLALVQLPFGGIYLVGGLSGAIAPYMSSENFEAAFLDKGRFADFMTDFAIYVVQDDYA
ALKGNAAYLNGLLQG
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
ttggttgccgatattggcgggacaaacacgcgcgttgccctttgtgatggggttgaggtg
ctcaaacccacgatccggcgctaccgtaacgcggacaatgacggctttacggcggtcctt
gcgcagtatctggccgcagaagggaatgtgcaaccaagggcggtctgcgtggcaattgcg
gggccggtcagtggcggcaaggggcggctcacaaaccttgactgggacatggacgaggcg
gagatcgcaaaggcaacaggtgcaaagtgcgtcgcattgctgaacgatcttcaggcgcag
ggttacgcgcttgatcaactggggccgggtgatcttgcccgcctgcgcaagggggccgcg
acacccaaaggggacgcgcgccttgttgtgaacctcggaaccgggttcaatgcctcgccc
gttttcatgacgcaggccggggcctatgtggcaacatccgaaagtggccatgccaacatg
cccatccggacggatcaggacctgcggctctgcgccttcatcgaggaacgtcacggattt
gccgcgattgatgacattctgtcgggccgcgggctggagcgtgtctttgcttttctggcg
catgaggccgggaaaaaccggttgctgaattcggcgcagatcatgtcggcctgcgcggat
gacagggatgaacttgccgtgcagacggtgcggtacttcgtgcgcctgacggcgctggtc
atcgccaaccttgcattggtgcaactgccctttggcggcatttatctggtgggcggactg
tccggggccattgcgccctatatgagcagcgagaatttcgaggcagcctttctggacaag
ggccgttttgctgacttcatgacggatttcgcgatctatgtcgtgcaggatgattacgcc
gcgctgaagggaaatgcggcctatctgaatggcctcttgcagggctga

DBGET integrated database retrieval system