KEGG   Roseobacter denitrificans: RD1_3806Help
Entry
RD1_3806          CDS       T00376                                 

Gene name
flhA
Definition
glutathione-dependent formaldehyde dehydrogenase (EC:1.1.1.284)
Orthology
K00121  
S-(hydroxymethyl)glutathione dehydrogenase / alcohol dehydrogenase [EC:1.1.1.284 1.1.1.1]
Organism
rde  Roseobacter denitrificans
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rde00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RD1_3806 (flhA)
   01220 Degradation of aromatic compounds
    RD1_3806 (flhA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RD1_3806 (flhA)
  Energy metabolism
   00680 Methane metabolism
    RD1_3806 (flhA)
  Lipid metabolism
   00071 Fatty acid degradation
    RD1_3806 (flhA)
  Amino acid metabolism
   00350 Tyrosine metabolism
    RD1_3806 (flhA)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    RD1_3806 (flhA)
   00626 Naphthalene degradation
    RD1_3806 (flhA)
Enzymes [BR:rde01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     RD1_3806 (flhA)
    1.1.1.284  S-(hydroxymethyl)glutathione dehydrogenase
     RD1_3806 (flhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RoseoBase: 
UniProt: 
Position
complement(3678510..3679622)
Genome map
AA seq 370 aa AA seqDB search
MRTRAAVAVAAGQPLEVMEVNLDGPRAGEVLVEIKATGLCHTDEFTRSGDDPEGIFPAIL
GHEGAGVVIEVGEGVTSLEVGDHVIPLYTPECRECDYCLNPKTNLCQKVRATQGAGLLPD
GSTRFSMLDGTPIHHYMGCSTFANHTVVPEIALAKVRKDAPFDKICYIGCGVTTGIGAVI
NTAKVEIGSTAAVFGLGGIGLNVIQGLRMAGADQIIGVDLNDDKEKMARHFGMTDFVNPS
KVEGDMVAHLVELSGGGCDYTFDATGNVNVMRTALEAAHKGWGESIIIGVAPAGAEISTR
PFQLVTGRVWRGTAFGGAKGRTDVPKIVDWYMDGKIEIDPMITHKLSLDEINHGFDLMHQ
GKSIRAVVEF
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgagaacgcgagcggcggttgcggttgcggctgggcagcctcttgaggtgatggaggtc
aatcttgatggcccgcgcgccggagaggttctggtcgagatcaaggcgacgggtctgtgt
catacggatgagttcacgcgctcgggcgatgaccccgaaggtatcttcccggcaatcctc
ggccatgagggcgcgggcgttgtcatcgaggtgggcgagggggtgaccagccttgaagtg
ggcgatcacgtgatcccgctctacacgccggagtgtcgcgaatgcgactactgcctgaac
cccaagaccaacctctgccagaaggtgcgcgccacgcagggcgcggggctgttgcctgat
ggctcaacccggttttcgatgctggatggcacgccgatccatcattacatgggctgctcg
acctttgccaaccacacggttgtgcccgaaatcgcgctggccaaggtgcgcaaggacgcg
ccctttgacaagatctgctacatcggctgcggcgtgaccaccggcatcggtgccgtcatt
aacacggcaaaggttgagattgggtcaacggccgccgtgtttggcctcggtggcatcggt
ctcaatgtgatccaggggctgcgcatggcgggcgcggatcagatcatcggcgtcgatctc
aacgacgacaaggaaaaaatggcgcgccatttcggcatgacggatttcgtcaaccccagc
aaggtcgagggcgacatggtcgcgcatctggtcgaactgtcgggtggggggtgcgactac
acctttgacgccacgggcaatgtgaacgtgatgcgcacggctctggaggccgcgcacaag
ggctggggcgagagcatcatcatcggcgtggcccctgcgggagccgagatttcgacgcgg
cccttccaactggtgacgggccgggtctggcgcggcacggccttcggcggggccaagggg
cgcacggatgtgccgaaaatcgtggactggtacatggacggcaagatcgagatcgacccc
atgatcacccacaaactcagcctggacgaaatcaaccacggcttcgacctcatgcaccag
ggaaaatcaatccgagccgtcgtggagttttga

DBGET integrated database retrieval system