KEGG   Roseobacter denitrificans: RD1_3849Help
Entry
RD1_3849          CDS       T00376                                 

Gene name
asnO
Definition
asparagine synthetase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
rde  Roseobacter denitrificans
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:rde00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RoseoBase: 
UniProt: 
Position
complement(3719683..3721383)
Genome map
AA seq 566 aa AA seqDB search
MHDRESVAHHGDASPQQAAEQSDLELLLALRVAKGPDFVHDVCGAFSLVFVHKETGRFEA
YRDHFGIFPFYYTVSDGAVTCASDLRACLHVSGIALNADATRLADYIHGEEVDFDRTAFE
QVLRLPPAHRLEAAGEGVTPRRYWQLEIPETTVKSDCPARLRDTLQTATGSCLRPEGRVG
AMLSGGLDSSALAGLAAKASVAPLKTVSFVYGADKAYDETPYIDAANELFGSVPHKIAIS
GAPPLDDLGPLIDEQMDLFLAPGLAKSRRIYSDARALGLTAVIDGHGGDEVISHGYGRLV
ELATRRKFWQLYREARGAAQVHSLPFLTLFASHIAHYSGMRPRNPLRRLCLKLARYQTKR
SSIAGWSEKPMALIAPDLQRKIGAEERYAPDPLLKTQADFNRAERLTHLRALKAPLMAQA
FEVLHRSASAAGVLPRYPFFDRRVVSLCLSFPAEMKLRDGRSRWVLREAMRGILPESIRT
RADKAEFGDEISAVIHEFYSDKDIGFFAPLGDFVNADAAERVRQQVIVREVTDVAAIRAL
WRLAVLSYWFKGLTEWREAQAKGMLI
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
ttgcatgaccgtgagagtgtggcccaccacggtgatgcatcgccccagcaggccgctgaa
cagtcggacctcgaattgctgctcgctttgcgcgtggccaaggggccggattttgtgcat
gacgtatgtggtgcattctcacttgtgttcgttcacaaggagactggtcgttttgaggcg
taccgggatcatttcggcatcttcccgttctattacacggtgtctgatggcgcggtgaca
tgcgcgtccgatttgcgcgcgtgtctgcatgtgtccggtatcgcgctgaatgccgatgcg
acgcgacttgccgattacatccacggcgaggaagtcgatttcgaccgcacagcctttgaa
caagtgctgcgcctgccaccagcgcatcgccttgaagcggcaggtgaaggggtgacgccg
cgccggtattggcaactggaaatccctgagactacggtgaaaagcgattgccccgcgcgc
ttgcgggacacgctgcagacggccaccggttcatgtctgcgccccgaaggacgtgtcggc
gcaatgttgagcggtgggttggattcctcggcccttgccgggttggcggcaaaggcatcg
gttgcgcctttgaaaaccgtctctttcgtatatggtgcggataaggcatatgacgaaacg
ccttacatcgacgcggccaatgaactcttcggcagtgtaccgcataaaattgcgatttcg
ggtgcgcccccgctcgatgaccttggcccgctgatcgacgaacagatggatttgtttctc
gcaccaggccttgcgaaatcgcggcgtatctacagcgatgcgcgcgcgttggggttgacg
gcggtgattgacgggcacggcggcgatgaggtcatatcgcatggatacgggcgcctcgtg
gaactggcgacacgccggaaattctggcagctttatcgtgaggcgcgtggcgcggcgcag
gtccatagcctgccgtttctcacccttttcgccagccatatcgcccattacagcggaatg
cgccccagaaatccgctgcgccgcctgtgtctgaagctggcacgctaccaaacaaagcgg
tcttccatcgctggctggtcggaaaagcccatggcgttgatcgcgcccgacctgcagcga
aagatcggcgcggaagaaagatacgcgcccgacccgttgttaaagacgcaggcggatttc
aatagggccgaaaggctgacgcacctgcgggccttgaaagcgccactgatggcgcaggcg
tttgaagtgctccaccgttcggccagtgccgccggtgttctgccaagatatccttttttc
gaccgccgtgtcgtatccctgtgcctgtcatttcctgcagaaatgaaactgcgtgatggc
cgcagcagatgggtgctgcgcgaggcgatgcgcgggatcctgccagagagcatcagaaca
cgcgcggacaaagcggaattcggggatgagatttctgccgtcatccatgagttttacagt
gataaagacattggatttttcgcgccgctgggtgatttcgtcaatgccgatgccgcagag
cgagtgcgccaacaggtgattgtgcgcgaagtcacagacgtggctgcgattagagcgttg
tggcgactggccgttttaagttattggtttaaagggcttactgaatggcgtgaagcacag
gccaaggggatgctgatttga

DBGET integrated database retrieval system