KEGG   Roseobacter denitrificans: RD1_3895Help
Entry
RD1_3895          CDS       T00376                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
rde  Roseobacter denitrificans
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rde00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RD1_3895 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RD1_3895 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RD1_3895 (trpA)
Enzymes [BR:rde01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     RD1_3895 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RoseoBase: 
UniProt: 
Position
3763301..3764092
Genome map
AA seq 263 aa AA seqDB search
MTRIDDKFAQLAKDGKKAFVAYVMAGDPNYETSLEVVKGLPAAGVDVIELGLPFTDPMAD
GPTIQLAGQRALEAGMTLQKTLDLARAFRKDDQTTPIVMMGYYNPIYSRGVDRFLAEAKD
AGIDGLIVVDLPPEEDSELCLPAQAAGLNFIRLATPTTDDKRLPRVLQNTSGFVYYVSIT
GITGAAEAQAVDVGPEVARIKSAAALPVIVGFGVNTPEKSKAIAEVADGVVVGSAIVGKI
GAGQSVSDVLAFVKTLADGAHSV
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgacccgtatcgacgacaaattcgcccagcttgccaaggacggcaagaaagccttcgtg
gcctatgtgatggcgggtgatccgaactatgaaacctcgctggaagtcgtcaaagggttg
cctgcggcgggggtggatgtgatcgaactgggcctgccttttacggacccgatggcggac
gggccgaccatccaactggccggtcaacgcgcactggaggcgggcatgacgctgcaaaag
acgctggacctcgcccgcgcctttcgcaaggacgaccagacaacccccatcgtgatgatg
ggctattacaatccgatctacagccgcggcgttgatcgttttctggccgaggccaaggac
gcgggcattgatggattgatcgttgtggatttgccaccggaggaagacagcgaattgtgt
ctgcccgcgcaagccgccggtctgaacttcatccgattggcaacgcccaccaccgatgac
aagcgcctgccgcgcgttttgcaaaacacctccggttttgtctattatgtctcgatcacg
ggcatcaccggtgcggccgaagcgcaagcggtcgatgtcggccccgaagtggcgcgtatc
aaatccgccgccgccctgcccgtaatcgtcggtttcggcgtgaacacccctgaaaagtcc
aaagccatcgcagaggtggccgacggcgtggtcgtggggtccgccattgtcggaaagatc
ggcgcaggccaaagcgtttcggatgttctggcctttgtcaaaacactcgcagacggcgcc
cacagcgtgtga

DBGET integrated database retrieval system