KEGG   Roseobacter denitrificans: RD1_3895Help
Entry
RD1_3895          CDS       T00376                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
rde  Roseobacter denitrificans
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rde00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RD1_3895 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RD1_3895 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RD1_3895 (trpA)
Enzymes [BR:rde01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     RD1_3895 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
RoseoBase: 
UniProt: 
Position
3763301..3764092
Genome map
AA seq 263 aa AA seqDB search
MTRIDDKFAQLAKDGKKAFVAYVMAGDPNYETSLEVVKGLPAAGVDVIELGLPFTDPMAD
GPTIQLAGQRALEAGMTLQKTLDLARAFRKDDQTTPIVMMGYYNPIYSRGVDRFLAEAKD
AGIDGLIVVDLPPEEDSELCLPAQAAGLNFIRLATPTTDDKRLPRVLQNTSGFVYYVSIT
GITGAAEAQAVDVGPEVARIKSAAALPVIVGFGVNTPEKSKAIAEVADGVVVGSAIVGKI
GAGQSVSDVLAFVKTLADGAHSV
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgacccgtatcgacgacaaattcgcccagcttgccaaggacggcaagaaagccttcgtg
gcctatgtgatggcgggtgatccgaactatgaaacctcgctggaagtcgtcaaagggttg
cctgcggcgggggtggatgtgatcgaactgggcctgccttttacggacccgatggcggac
gggccgaccatccaactggccggtcaacgcgcactggaggcgggcatgacgctgcaaaag
acgctggacctcgcccgcgcctttcgcaaggacgaccagacaacccccatcgtgatgatg
ggctattacaatccgatctacagccgcggcgttgatcgttttctggccgaggccaaggac
gcgggcattgatggattgatcgttgtggatttgccaccggaggaagacagcgaattgtgt
ctgcccgcgcaagccgccggtctgaacttcatccgattggcaacgcccaccaccgatgac
aagcgcctgccgcgcgttttgcaaaacacctccggttttgtctattatgtctcgatcacg
ggcatcaccggtgcggccgaagcgcaagcggtcgatgtcggccccgaagtggcgcgtatc
aaatccgccgccgccctgcccgtaatcgtcggtttcggcgtgaacacccctgaaaagtcc
aaagccatcgcagaggtggccgacggcgtggtcgtggggtccgccattgtcggaaagatc
ggcgcaggccaaagcgtttcggatgttctggcctttgtcaaaacactcgcagacggcgcc
cacagcgtgtga

DBGET integrated database retrieval system