KEGG   Roseobacter denitrificans: RD1_3906Help
Entry
RD1_3906          CDS       T00376                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta subunit (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
rde  Roseobacter denitrificans
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rde00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RD1_3906 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RD1_3906 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RD1_3906 (trpB)
Enzymes [BR:rde01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     RD1_3906 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
RoseoBase: 
UniProt: 
Position
complement(3771597..3772829)
Genome map
AA seq 410 aa AA seqDB search
MANDLFNSFMTGPDENGRFGDFGGRFVSETLMPLILELEEQYENAKTDESFWAEMNDLWT
HYVGRPSPLYFAERLTDHLGGAKVYMKRDELNHTGAHKINNVLGQIILARRMGKTRIIAE
TGAGQHGVATATVCAKFGLKCVVYMGAHDVERQAPNVFRMRLLGAEVVPVTSGRGTLKDA
MNDALRDWVTNVRDTFYCIGTVAGPHPYPAMVRDFQAIIGKEVRTQMTAAEGRFPDTVIA
AIGGGSNAMGLFYPFLDDKEVGIIGVEAGGKGVNAKMEHCASLTGGRPGVLHGNRTYLLQ
DDDGQILEGFSISAGLDYPGIGPEHAWLHDIGRAQYVSITDVEALEAFQLCCELEGIIPA
LEPSHALAHVMKIAPDLPSDHIICMNMCGRGDKDIFTVAKALGFEMGEFA
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atggccaatgatcttttcaattctttcatgacgggtccggatgaaaacggacgttttggc
gatttcggggggcgctttgtctccgagacgctgatgccgctgattctggagttggaagag
caatatgaaaacgccaagacggatgaaagtttctgggccgaaatgaatgacctgtggacc
cattacgtgggccgacccagcccgctttattttgccgaacgcctgacggatcatctgggc
ggcgcaaaggtctatatgaaacgtgatgagctgaaccataccggcgcgcacaagatcaac
aacgtgctgggccagatcattctggcgcgccggatgggcaaaacgcgcatcattgcggaa
acgggcgcgggtcagcatggcgtggccacggcgacggtctgtgcaaagttcggtttgaaa
tgtgtcgtctacatgggcgcgcatgacgttgaacggcaggccccgaatgtgttccgcatg
cggcttctgggggctgaggttgtgccggtaacctccggtcgtgggacgctgaaggatgcg
atgaacgacgccctgcgcgactgggtgaccaatgtgcgcgacacgttttactgcatcggg
acggttgcgggtccacatccttaccctgccatggtgcgggattttcaggcgatcatcggc
aaggaagtgcgcacgcaaatgaccgctgcggagggccgcttcccggatacggtgatcgca
gcgatcgggggcgggtccaatgccatgggcctgttctatccgtttctcgacgacaaggag
gttggcatcatcggcgtcgaggcgggcggcaaaggcgtcaatgccaagatggagcattgc
gcatcgctgacaggcgggcggcccggcgtgctgcatggcaaccggacgtatctgttgcag
gatgatgacggtcagattctcgaagggttctcaatttcggcgggtctggattacccgggc
atcgggccggaacatgcatggctgcatgacatcgggcgcgcgcaatatgtgtcgatcacg
gatgtcgaagcgcttgaggcgtttcagttgtgctgcgaacttgaaggcatcatcccggcg
ctggaacccagccacgcgctggcccatgtgatgaaaatcgcacctgacctgccatctgac
cacatcatctgcatgaacatgtgcgggcgtggcgacaaggatatctttaccgttgccaaa
gcgcttgggttcgagatgggggagtttgcctga

DBGET integrated database retrieval system