KEGG   Roseobacter denitrificans: RD1_3972Help
Entry
RD1_3972          CDS       T00376                                 

Gene name
fadA
Definition
(GenBank) fatty acid oxidation complex beta subunit
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rde  Roseobacter denitrificans
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Module
Ethylmalonyl pathway
Brite
KEGG Orthology (KO) [BR:rde00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    RD1_3972 (fadA)
   00630 Glyoxylate and dicarboxylate metabolism
    RD1_3972 (fadA)
   00640 Propanoate metabolism
    RD1_3972 (fadA)
   00650 Butanoate metabolism
    RD1_3972 (fadA)
  Lipid metabolism
   00071 Fatty acid degradation
    RD1_3972 (fadA)
   00072 Synthesis and degradation of ketone bodies
    RD1_3972 (fadA)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RD1_3972 (fadA)
   00310 Lysine degradation
    RD1_3972 (fadA)
   00380 Tryptophan metabolism
    RD1_3972 (fadA)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    RD1_3972 (fadA)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RD1_3972 (fadA)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    RD1_3972 (fadA)
Enzymes [BR:rde01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     RD1_3972 (fadA)
Exosome [BR:rde04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RD1_3972 (fadA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
RoseoBase: 
UniProt: 
Position
3829356..3830567
Genome map
AA seq 403 aa AA seqDB search
MTDAYIYDALRTPRGKGRKDGSLHEVTSLRLSALTLNALKDRNNLEGHAVEDVIWGNVTQ
VMEQGGCLARSAVLASDLDERIPGLAINRFCASGMEAVNLAANQVRGGAGQAYIAGGVEM
MGRVAMGSDGAAIAVDPTLAMEKHFVPQGISADIIATEYGFSRDDADTLAVESQRRAKQA
WDEGRFDKSVIEVRDQNGLKILDHDEYMRPQTDMQSLGALNPAFQAMGEVMPGFDKVALM
KYPHLERINHIHHAGNSSGIVDGAAAVLIGNKEFGEEHGLKPRARIRATAKIGTDPTIML
TGPVPVTEKILADSGMDIKDIDLFEVNEAFAAVVLRFLQAFDVDDAKVNVNGGSIAMGHP
LGATGAIIIGTLLDELERDDKEVGLATLCIASGMGAATIIERV
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacgcctatatctatgacgcgctgcgcaccccgcgtggcaagggccgcaaggac
ggcagcctgcacgaggtgacatccctgcgcctgtccgcgctgacgctgaacgcgctgaag
gaccgcaacaaccttgagggccacgctgttgaggatgtgatctggggaaatgtgacacag
gtgatggaacagggcggctgccttgcgcgctctgccgtgttggcgtccgatctggatgaa
cgcatccccggtctggcgattaaccgcttttgcgcctctggcatggaggcggtcaacctc
gccgccaatcaggtgcgcggtggtgccggtcaggcctacatcgcgggcggggtcgagatg
atgggccgtgtggccatgggcagtgacggggcggccatcgcggttgatccgacgctcgca
atggaaaaacacttcgtcccccaaggcatcagcgcggatatcatcgcgaccgaatatggc
tttagccgcgatgatgcggacacgctggcggtcgaatcccagcgtcgcgcaaaacaggca
tgggatgaggggcgttttgacaaatcggtcatcgaggtgcgcgaccagaacgggctgaag
attctggatcacgacgaatacatgcgcccgcaaaccgacatgcaaagccttggcgcgctg
aaccccgcctttcaggcgatgggagaggtcatgcccggcttcgacaaggtcgcgctgatg
aaatacccgcatcttgagcggatcaaccatatccaccacgcgggcaactcatcgggtatc
gtcgatggggcggcagccgttctgatcggcaacaaagagttcggcgaagagcacggactg
aagccgcgcgcccgcatccgcgccacggcgaaaatcggcaccgaccccacgatcatgctg
accggtcctgtgccggtgaccgaaaaaatcctcgccgacagtgggatggacatcaaggac
attgatctttttgaggtgaacgaggcctttgccgccgtggtgctgcggtttttgcaggcg
tttgatgtcgatgatgcgaaggtgaacgtcaacggcggctcgatcgccatgggccatccg
cttggcgcgaccggggccatcatcatcggcacgctgctggatgagttggagcgcgacgac
aaagaggtcggtctggctacgctctgcatcgcctccggcatgggtgccgcgaccatcatc
gagcgcgtttaa

DBGET integrated database retrieval system