KEGG   Roseobacter denitrificans: RD1_3979Help
Entry
RD1_3979          CDS       T00376                                 

Gene name
deoA
Definition
(GenBank) thymidine phosphorylase
  KO
K00758  thymidine phosphorylase [EC:2.4.2.4]
Organism
rde  Roseobacter denitrificans
Pathway
rde00240  Pyrimidine metabolism
rde01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rde00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    RD1_3979 (deoA)
Enzymes [BR:rde01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     RD1_3979 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_3 PYNP_C Glycos_trans_3N
Motif
Other DBs
NCBI-ProteinID: ABG33432
RoseoBase: RD1_3979
UniProt: Q161B1
Position
complement(3837672..3838982)
Genome map
AA seq 436 aa AA seqDB search
MADARSVLARLRHGAALTTTDMQWVAQALADHGMSDAQAGAFAMGICARGLRDPERVALT
LAMRDSGKVLRWDMPGPVLDKHSTGGVGDCISLVLAPALAACGAYVPMISGRGLGHTGGT
LDKLEAIPGLVTQLDEGRFRAVVAEAGCAIVGASADIAPADRRLYAVRDVTSTVDSLDLI
TASILSKKLAAGLEGLVLDVKIGSGAFMKDAQAARALAQALVSTANAAECKTTALISDMS
QPLAPSLGNALEVAEVMRVLTGAADGPLVELSVALGGVLLANAGSVNDVQAGADAIRAAI
REGRAATQFGRMVAAMGGPVHFVENWQRFLPEATVIREVSALQSGRIAAIDGEALGLAVV
NLGGGRRIETDKIDRRVGLTQVVRLGAAVRKGQPLAVVHASRPDDADRAVAAVRAAISLT
DSATVAVPDLIHERVG
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atggcagatgcgcgttccgttcttgcgcggctgcgccatggtgcggccctgaccacgaca
gatatgcaatgggttgcacaggcgcttgcggatcacgggatgagtgatgcgcaggccggt
gcctttgccatggggatttgtgcccggggcctgcgcgatcctgagcgggtcgccctgacg
ctggcgatgcgtgacagcggcaaggtgttgcggtgggatatgccggggcctgtgcttgat
aaacactccaccggcggcgtgggcgattgcatttctctggtgcttgcgcctgcactggcg
gcctgcggggcctatgtgccgatgatatccggtcgcggcctcgggcataccggcggaaca
ctggataagctggaggcgataccgggtcttgtcacccaactggacgagggccggtttcgc
gccgtcgtggctgaggcaggttgcgcgatcgtaggggccagcgccgatatcgcgccggcg
gatcgcaggctttatgcagtacgagatgtgacctcgacggttgatagtcttgatctgatc
accgcgtcgatcctgtccaagaagcttgcagcgggccttgagggtctggtgctggatgtc
aagatcggcagcggcgcattcatgaaagatgcccaggccgcacgcgccctggcacaggca
ctggtcagcacggcgaatgctgcggagtgcaaaaccaccgcgctgatcagcgacatgagc
caaccgctggccccgagccttggcaatgcgcttgaggtggccgaagtcatgcgcgttctg
acaggtgccgctgatggcccgctggttgaactgtcggtcgcgctgggcggggtgctcttg
gccaatgcaggttctgtcaacgacgtgcaggccggggcggatgccatccgggccgcgatc
agggagggccgcgccgcgacccagttcgggcggatggttgccgccatgggagggccggtg
catttcgtggaaaactggcaacgcttcctgcctgaagcgaccgtgatccgcgaggtgtcg
gccctgcaatcaggtcgcatcgctgcgattgacggtgaagccttggggctggcggtggtc
aacctcggcggtggtcggcgcattgagacagacaagatcgaccgccgcgtgggcctgacg
caggtggtgcggcttggtgcggcagtgcgcaagggtcagcctttggcggttgtgcatgcc
agccgacccgatgatgcggaccgggcggtagctgctgtgcgcgccgcgatttcgctgacg
gacagcgcgacagtggctgtgccggacctgatacatgaaagggttggatga

DBGET integrated database retrieval system