KEGG   Roseobacter denitrificans: RD1_3979Help
Entry
RD1_3979          CDS       T00376                                 

Gene name
deoA
Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
rde  Roseobacter denitrificans
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rde00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    RD1_3979 (deoA)
Enzymes [BR:rde01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     RD1_3979 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RoseoBase: 
UniProt: 
Position
complement(3837672..3838982)
Genome map
AA seq 436 aa AA seqDB search
MADARSVLARLRHGAALTTTDMQWVAQALADHGMSDAQAGAFAMGICARGLRDPERVALT
LAMRDSGKVLRWDMPGPVLDKHSTGGVGDCISLVLAPALAACGAYVPMISGRGLGHTGGT
LDKLEAIPGLVTQLDEGRFRAVVAEAGCAIVGASADIAPADRRLYAVRDVTSTVDSLDLI
TASILSKKLAAGLEGLVLDVKIGSGAFMKDAQAARALAQALVSTANAAECKTTALISDMS
QPLAPSLGNALEVAEVMRVLTGAADGPLVELSVALGGVLLANAGSVNDVQAGADAIRAAI
REGRAATQFGRMVAAMGGPVHFVENWQRFLPEATVIREVSALQSGRIAAIDGEALGLAVV
NLGGGRRIETDKIDRRVGLTQVVRLGAAVRKGQPLAVVHASRPDDADRAVAAVRAAISLT
DSATVAVPDLIHERVG
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atggcagatgcgcgttccgttcttgcgcggctgcgccatggtgcggccctgaccacgaca
gatatgcaatgggttgcacaggcgcttgcggatcacgggatgagtgatgcgcaggccggt
gcctttgccatggggatttgtgcccggggcctgcgcgatcctgagcgggtcgccctgacg
ctggcgatgcgtgacagcggcaaggtgttgcggtgggatatgccggggcctgtgcttgat
aaacactccaccggcggcgtgggcgattgcatttctctggtgcttgcgcctgcactggcg
gcctgcggggcctatgtgccgatgatatccggtcgcggcctcgggcataccggcggaaca
ctggataagctggaggcgataccgggtcttgtcacccaactggacgagggccggtttcgc
gccgtcgtggctgaggcaggttgcgcgatcgtaggggccagcgccgatatcgcgccggcg
gatcgcaggctttatgcagtacgagatgtgacctcgacggttgatagtcttgatctgatc
accgcgtcgatcctgtccaagaagcttgcagcgggccttgagggtctggtgctggatgtc
aagatcggcagcggcgcattcatgaaagatgcccaggccgcacgcgccctggcacaggca
ctggtcagcacggcgaatgctgcggagtgcaaaaccaccgcgctgatcagcgacatgagc
caaccgctggccccgagccttggcaatgcgcttgaggtggccgaagtcatgcgcgttctg
acaggtgccgctgatggcccgctggttgaactgtcggtcgcgctgggcggggtgctcttg
gccaatgcaggttctgtcaacgacgtgcaggccggggcggatgccatccgggccgcgatc
agggagggccgcgccgcgacccagttcgggcggatggttgccgccatgggagggccggtg
catttcgtggaaaactggcaacgcttcctgcctgaagcgaccgtgatccgcgaggtgtcg
gccctgcaatcaggtcgcatcgctgcgattgacggtgaagccttggggctggcggtggtc
aacctcggcggtggtcggcgcattgagacagacaagatcgaccgccgcgtgggcctgacg
caggtggtgcggcttggtgcggcagtgcgcaagggtcagcctttggcggttgtgcatgcc
agccgacccgatgatgcggaccgggcggtagctgctgtgcgcgccgcgatttcgctgacg
gacagcgcgacagtggctgtgccggacctgatacatgaaagggttggatga

  All links  
No link information was found.   
DBGET integrated database retrieval system