KEGG   Rothia dentocariosa: HMPREF0733_10006Help
Entry
HMPREF0733_10006  CDS       T01343                                 

Gene name
sucB
Definition
dihydrolipoyllysine-residue succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
rdn  Rothia dentocariosa
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rdn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HMPREF0733_10006 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    HMPREF0733_10006 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    HMPREF0733_10006 (sucB)
Enzymes [BR:rdn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     HMPREF0733_10006 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7997..9670
Genome map
AA seq 557 aa AA seqDB search
MSHTVELPALGESVTEGTVTRWLVAVGDTVAVDDPIVEVSTDKVDTEIPSPVAGVVEQIL
VEEDEDVEVGAALVVIGDGSSAPTAAPAAPAAEAPAASAPAAPEAPAAAAASAAGSVSGQ
EVTLPALGESVTEGTVTRWLKEVGEQVEVDEPLVEVSTDKVDTEIPSPVAGTLLEIRIPE
DEEAEVGQVLAIIGDSSAAAAPAAPAAPAPAAAAPAPATPAAPAAPASAPDTPATPAAPA
ADGEAYVTPLVRKLAKDNGIDLSTVKGTGVGGRIRKQDVQAAIAAKGSTAPAAAPAASAA
PAADGAPKAAHTFEVSPKRGTVEKTARIRQVIAKRMRESLDISTQLTQVTEVDMTRVAQL
RAKAKDGFLAREGAKLTFLPFFAQAVTEALQQHPALNASMTEDLKQITYPDSENVAIAVD
TPKGLLVPVIKNASDLGIAGLAKAIGDLGGRARTGDIAPEELTGSTFTITNIGSFGALFD
TPIINQPNVAILGTGSIVKRPMVVKDVDGNDSIAIRSMCYLSLTYDHRVVDGADAGRFLY
TLKTRLEEANFEAELGL
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atgtcccacaccgtagaattgcccgcattgggcgaatccgtgaccgaaggcaccgtgacc
cgctggcttgtagctgtcggtgacactgttgctgtggacgatcctattgtcgaggtttcc
accgataaggtcgacaccgagatcccctcgcccgtagcaggcgttgttgagcagatcttg
gtggaagaagacgaagatgttgaggttggcgctgctctcgttgtcattggcgatggttcc
agtgctcccacagctgcacctgccgcgcccgctgccgaggctcctgcagcatccgcccct
gccgctcctgaggcacccgcagctgctgctgcgtccgctgctggctctgtatccggtcag
gaagtaactcttcccgcattgggcgagtctgtcacagagggtaccgtgacccgctggctg
aaggaagttggtgagcaggtcgaggtagacgaacctctcgtagaggtttctaccgataag
gtcgataccgagattccttcgcccgtagcaggtaccctgctcgaaattcgcattccggaa
gacgaggaagcagaggtcggccaggttctcgccatcattggtgattcttccgccgcagct
gctcctgctgcaccggccgcccccgcgcctgctgcggcagcaccggcgcctgcaactccc
gctgcgcctgcagctcctgcttctgcgcccgacacccctgctaccccggcggctcccgcc
gccgatggcgaagcatacgtaaccccgctggttcgtaagctcgccaaagacaatggtatt
gacctgtccactgtgaagggcaccggcgtaggcggtcgtatccgcaagcaggatgttcag
gcagctattgccgctaagggctcgaccgctcctgctgcagcacccgccgcgtcagcagct
cccgccgcagacggtgctcccaaggcagcacataccttcgaagtttcgcccaagcgtggt
accgtcgaaaagaccgcacgcattcgccaggttattgcaaaacgtatgcgcgagtccctc
gatatttccactcagctgactcaggttaccgaagtggatatgacccgtgtagcacagctg
cgtgccaaggctaaggacggcttcctcgctcgtgagggcgcaaagctgaccttcctgcct
ttcttcgcacaggctgttaccgaggctctgcagcagcaccccgcactgaacgcttccatg
accgaggatctgaagcagattacctaccccgattccgagaacgtcgcgatcgctgtagat
acccccaagggtctgcttgttcccgttatcaagaacgcatcggatctcggcatcgctggc
ttggctaaggcaattggtgacttgggtggacgtgcccgcaccggcgatatcgctcccgaa
gagctgaccggctctacctttaccatcaccaatatcggttccttcggggctctgtttgat
accccgattatcaaccagccgaacgtggcgatcttgggtaccggctccatcgtgaagcgc
cccatggtggttaaggacgttgatggcaacgattcaattgcgattcgctccatgtgctac
ctctccctcacctacgatcaccgcgtggtcgatggtgcggatgcaggtcgcttcctgtac
accctcaagactcgcctggaagaggcaaactttgaggctgagctcggtctctaa

DBGET integrated database retrieval system