KEGG   Rothia dentocariosa: HMPREF0733_10006Help
Entry
HMPREF0733_10006  CDS       T01343                                 

Gene name
sucB
Definition
dihydrolipoyllysine-residue succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
rdn  Rothia dentocariosa
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rdn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HMPREF0733_10006 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    HMPREF0733_10006 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    HMPREF0733_10006 (sucB)
Enzymes [BR:rdn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     HMPREF0733_10006 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7997..9670
Genome map
AA seq 557 aa AA seqDB search
MSHTVELPALGESVTEGTVTRWLVAVGDTVAVDDPIVEVSTDKVDTEIPSPVAGVVEQIL
VEEDEDVEVGAALVVIGDGSSAPTAAPAAPAAEAPAASAPAAPEAPAAAAASAAGSVSGQ
EVTLPALGESVTEGTVTRWLKEVGEQVEVDEPLVEVSTDKVDTEIPSPVAGTLLEIRIPE
DEEAEVGQVLAIIGDSSAAAAPAAPAAPAPAAAAPAPATPAAPAAPASAPDTPATPAAPA
ADGEAYVTPLVRKLAKDNGIDLSTVKGTGVGGRIRKQDVQAAIAAKGSTAPAAAPAASAA
PAADGAPKAAHTFEVSPKRGTVEKTARIRQVIAKRMRESLDISTQLTQVTEVDMTRVAQL
RAKAKDGFLAREGAKLTFLPFFAQAVTEALQQHPALNASMTEDLKQITYPDSENVAIAVD
TPKGLLVPVIKNASDLGIAGLAKAIGDLGGRARTGDIAPEELTGSTFTITNIGSFGALFD
TPIINQPNVAILGTGSIVKRPMVVKDVDGNDSIAIRSMCYLSLTYDHRVVDGADAGRFLY
TLKTRLEEANFEAELGL
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atgtcccacaccgtagaattgcccgcattgggcgaatccgtgaccgaaggcaccgtgacc
cgctggcttgtagctgtcggtgacactgttgctgtggacgatcctattgtcgaggtttcc
accgataaggtcgacaccgagatcccctcgcccgtagcaggcgttgttgagcagatcttg
gtggaagaagacgaagatgttgaggttggcgctgctctcgttgtcattggcgatggttcc
agtgctcccacagctgcacctgccgcgcccgctgccgaggctcctgcagcatccgcccct
gccgctcctgaggcacccgcagctgctgctgcgtccgctgctggctctgtatccggtcag
gaagtaactcttcccgcattgggcgagtctgtcacagagggtaccgtgacccgctggctg
aaggaagttggtgagcaggtcgaggtagacgaacctctcgtagaggtttctaccgataag
gtcgataccgagattccttcgcccgtagcaggtaccctgctcgaaattcgcattccggaa
gacgaggaagcagaggtcggccaggttctcgccatcattggtgattcttccgccgcagct
gctcctgctgcaccggccgcccccgcgcctgctgcggcagcaccggcgcctgcaactccc
gctgcgcctgcagctcctgcttctgcgcccgacacccctgctaccccggcggctcccgcc
gccgatggcgaagcatacgtaaccccgctggttcgtaagctcgccaaagacaatggtatt
gacctgtccactgtgaagggcaccggcgtaggcggtcgtatccgcaagcaggatgttcag
gcagctattgccgctaagggctcgaccgctcctgctgcagcacccgccgcgtcagcagct
cccgccgcagacggtgctcccaaggcagcacataccttcgaagtttcgcccaagcgtggt
accgtcgaaaagaccgcacgcattcgccaggttattgcaaaacgtatgcgcgagtccctc
gatatttccactcagctgactcaggttaccgaagtggatatgacccgtgtagcacagctg
cgtgccaaggctaaggacggcttcctcgctcgtgagggcgcaaagctgaccttcctgcct
ttcttcgcacaggctgttaccgaggctctgcagcagcaccccgcactgaacgcttccatg
accgaggatctgaagcagattacctaccccgattccgagaacgtcgcgatcgctgtagat
acccccaagggtctgcttgttcccgttatcaagaacgcatcggatctcggcatcgctggc
ttggctaaggcaattggtgacttgggtggacgtgcccgcaccggcgatatcgctcccgaa
gagctgaccggctctacctttaccatcaccaatatcggttccttcggggctctgtttgat
accccgattatcaaccagccgaacgtggcgatcttgggtaccggctccatcgtgaagcgc
cccatggtggttaaggacgttgatggcaacgattcaattgcgattcgctccatgtgctac
ctctccctcacctacgatcaccgcgtggtcgatggtgcggatgcaggtcgcttcctgtac
accctcaagactcgcctggaagaggcaaactttgaggctgagctcggtctctaa

DBGET integrated database retrieval system