KEGG   Rothia dentocariosa: HMPREF0733_10114Help
Entry
HMPREF0733_10114  CDS       T01343                                 

Gene name
hemG
Definition
protoporphyrinogen oxidase (EC:1.3.3.4)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
rdn  Rothia dentocariosa
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:rdn00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(135070..136533)
Genome map
AA seq 487 aa AA seqDB search
MNMVHQHKNHHAPSAIVVGGGISGLLAARRLTDAGVNVTVLDQNDYLGGALGAHKVAGLV
LDSGAESYATRTPTVTNLVKELGLDDQIVHPNSHGSWLYLPQGARKTPSTGIMGIPGDLS
DKSLAGVLGKSGLRRARMDKVLPASVGANAKTLGELVRARMGKKVLDNLVAPVVSGVYST
HPDMLDIDAVIPGLREGLKKHKSLAAASAAIRAQAPAGSQVAGLSGGMHLLIEQLIEKMP
APVRYIPECGVIAVDRDPITNEWVVIRRRSDGEKAASVGADYLVIATDGSTAARLLGPHI
KGSSLPNIDPGPEVALVTLVVDQPALNSNPRGTGLLVSEAVTNVRAKALTHATAKWAWVA
EEAGKNRHVVRLSYGRGGEQSTFSDVSLDEDQLITLALRDASKLLDVPITAQNLVDADVV
RWNGVLPLSTPGYRERVQLFRERAAELDTVCTVGSWAAGSGLAAVVRDTQEQLDQFIAHI
TQKRASK
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgaatatggtacatcagcacaagaatcatcatgcaccaagcgccatcgtagtcggcggc
ggcatttctgggttgttggcggcgcgtcgtctgaccgatgccggagtgaacgtgaccgtc
ctagaccagaacgattatctggggggcgccctcggcgcgcataaggtcgccggtttggtg
ctggattccggtgcggaatcctatgcgacccgaaccccaaccgtgacaaacctcgtcaaa
gagcttggtttagacgaccagattgtgcatcccaactcccacggttcatggttgtatctg
cctcagggtgcccgaaagactccgagcactggaattatgggcattcccggcgatctttct
gataaatctttggctggtgtgctcggtaaaagcggtctgcgccgcgctcgcatggataag
gtgctgcctgcttcggttggagcaaacgcaaagacgctgggcgaactggtacgtgcccgt
atgggtaaaaaagtactcgataatctggttgcgcccgtggtctccggggtgtactcgacc
cacccggatatgctcgatattgatgccgttatccccggcttacgcgaagggctgaaaaag
cataagtccctagctgccgcctccgccgcgatacgcgctcaagcacccgcaggttcgcaa
gtcgctggactttctgggggcatgcacttgctgatcgaacagcttatcgagaagatgccc
gcacccgtgcggtacattcccgaatgcggcgtgattgcggtggaccgtgaccccatcacc
aatgaatgggtggtaattcgccgccgcagcgacggcgaaaaagccgcctcggtgggcgcc
gattatttggtgattgctaccgatggttccaccgctgcgcgtctgctcggaccgcatatt
aagggaagttctctgcctaatattgaccccggccccgaggttgctctcgtaacgctcgtt
gtcgatcagcccgcgcttaactcgaacccgcgtggtacgggtctgctggtttccgaagct
gtgacgaatgtgcgcgccaaagcgctcacccatgctaccgctaaatgggcgtgggtcgct
gaagaggcgggtaagaaccgccacgtggtgcggctttcctacggccgcgggggagaacag
agtaccttctctgacgtttctcttgacgaagaccaactgatcactctcgccttgcgcgac
gcctcgaaactgctcgatgtgcccattactgcccaaaatctggtggatgcggatgtggtt
cgctggaacggcgtgctgcctctctcaacgcccggataccgcgagcgtgtgcagcttttc
cgtgaacgcgcggcagaactcgataccgtctgcacggttggttcgtgggccgcagggtcc
ggactcgccgccgtggtgcgcgatacccaggagcagctggatcaattcatcgcacacata
acacaaaaacgcgcctcgaagtga

DBGET integrated database retrieval system