KEGG   Rothia dentocariosa: HMPREF0733_10210Help
Entry
HMPREF0733_10210  CDS       T01343                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
rdn  Rothia dentocariosa
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rdn00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    HMPREF0733_10210 (galU)
   00052 Galactose metabolism
    HMPREF0733_10210 (galU)
   00500 Starch and sucrose metabolism
    HMPREF0733_10210 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    HMPREF0733_10210 (galU)
Enzymes [BR:rdn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     HMPREF0733_10210 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(227758..228675)
Genome map
AA seq 305 aa AA seqDB search
MLIGMTKVSKSVTKAVIPAAGLGTRFLPATKATPKEMLPVVDRPAIQYVVEEAIRAGLND
VLMITGRNKRALEDHFDRVPVLESQLAEQGKDALLKAVEATNELGELHYVRQGDPKGLGH
AVLRGKVHVGDEPFAVLLGDDLIDEKEDLLSRMVEVQQATGGSVIALMEVPHESISAYGA
AAIEAVEGQDGYVKVTGLVEKPAPEEAPSNYAVIGRYVLSSKVFEVLENTAPGRGNEIQL
TDALQTLAVGTGEGEGVYGVVFKGRRFDTGDKLSYLKANVILASEREDLGPELREWLKEF
ADKNC
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgcttattggtatgactaaagtatctaagtctgtcactaaggctgttattccggcggct
ggtctggggaccaggttcttgcccgcaacgaaggcgactcctaaggaaatgcttccggtc
gttgatcgccccgcaattcagtacgtggtagaagaggcaatccgcgccggcctgaacgat
gttcttatgattaccggccgtaacaagcgtgcgcttgaagaccattttgaccgtgttccg
gtcctagaaagtcagctggccgagcagggtaaagacgcccttctgaaagctgttgaagca
acgaatgagttgggtgaactgcactatgtgcgccagggcgaccctaaaggtctgggccat
gcagttttgcgcggcaaggtacatgtaggggatgaacccttcgcggttttgctgggcgat
gacctgatcgacgaaaaagaggatttgctctcgcgaatggtcgaggttcagcaggctacc
ggcggttccgtgatcgctcttatggaggttccccacgagtctatctcagcctacggtgcc
gctgctatcgaggcggttgaaggtcaggacggctacgtgaaggtcaccggtcttgttgag
aagcccgcccccgaggaagcaccctcgaactatgcggtgattggtcgctacgtgctcagc
tcgaaggtattcgaggtgctggaaaacacggctccgggtcgcggcaacgaaattcagctg
accgatgcactgcagactttggcagtcggcaccggcgaaggtgagggcgtatacggtgtg
gtcttcaaggggcgccgcttcgatacgggggataagctctcgtatctgaaggcaaacgtt
attcttgcttccgaacgcgaagatctcggccctgaacttcgtgaatggctgaaagaattt
gccgataagaactgctaa

DBGET integrated database retrieval system