KEGG   Rothia dentocariosa: HMPREF0733_10373Help
Entry
HMPREF0733_10373  CDS       T01343                                 

Gene name
folA
Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
rdn  Rothia dentocariosa
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:rdn00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:rdn00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
399140..399826
Genome map
AA seq 228 aa AA seqDB search
MREYESPSLARPCLGAIWAQTDAGIIGRDGTMPWRAPEDLAHFKTVTVGKPVIMGRRTWE
SFPPRFRPLPERTNIVISRSITGGSAAPLKRDGAFWVPSLDAALTLASNTPLTPNDNQHP
DSPHQQVDAWIIGGGSVYAEALSREDLPSFGRVEIIERTFFYCQEGNEITGDTYAPELAV
EGFVAADEPARWRILGESAWEKSERGYLLDASGGKNPMYYSFQTLARL
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgagtatgaatccccctccctcgcacgaccgtgcctcggcgctatttgggcgcag
accgatgcgggtattattgggcgcgacggcaccatgccctggcgtgcccccgaagacctt
gcgcatttcaaaaccgtcaccgtgggtaagcccgtcatcatggggcggcgcacttgggag
tcttttccaccgcgttttcgaccgctgcctgagcgcaccaatatcgtcatcagccgcagt
attacgggcggttcagccgcgcctcttaaacgcgatggcgcgttttgggttccgtcgctg
gatgcggctctcacccttgcgagcaacacgcctttaacgcccaacgataaccagcacccg
gattcaccacatcagcaagttgatgcttggatcattggcggcggctccgtctatgcggag
gcactttcccgcgaggatttaccctcctttggccgcgtcgaaattatcgaacgcaccttc
ttctattgtcaggaaggtaacgagattacgggtgatacctacgcccccgaacttgcggta
gaaggatttgtggctgcggacgaaccggcgcgatggcgcatcctgggtgaaagcgcctgg
gaaaaaagcgagcgcggctacctgctggatgcttcgggcgggaaaaatcccatgtactac
tcatttcaaaccctagcccgcctctga

DBGET integrated database retrieval system